MTAC2D1 Antibody - BSA Free

Western Blot: MTAC2D1 Antibody [NBP1-55422] - MCF-7 whole cell lysates, concentration 0.2-1 ug/ml.

Product Discontinued

MTAC2D1 Antibody - BSA Free Summary

• Description: The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.
• Immunogen: Synthetic peptides corresponding to TC2N(tandem C2 domains, nuclear) The peptide sequence was selected from the middle region of TC2N. Peptide sequence SWPSSYGDTPTVSIKGILTLPKPVHFKSSAKEGSNAIEFMETFVFAIKLQ. The peptide sequence for this immunogen was taken from within the described region.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: TC2N
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 55 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MTAC2D1 Antibody - BSA Free

• C2 calcium-dependent domain containing 1
• C2CD1
• chromosome 14 open reading frame 47
• FLJ36557
• membrane targeting (tandem) C2 domain containing 1
• Membrane targeting tandem C2 domain-containing protein 1
• MTAC2D1
• Tac2-NC14orf47
• tandem C2 domains nuclear protein
• tandem C2 domains, nuclear
• Tandem C2 protein in nucleus

Background

The specific function of TC2N is not yet known.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: TC2N
• Uniprot:
  • Q8N9U0(Human)