MST2/STK3 Antibody (5J1I4)

Western Blot: MST2/STK3 Antibody (5J1I4) [NBP3-16737] - Western blot analysis of extracts of various cell lines, using MST2/STK3 Rabbit mAb (NBP3-16737) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 1s.

Immunocytochemistry/Immunofluorescence: MST2/STK3 Antibody (5J1I4) [NBP3-16737] - Immunofluorescence analysis of NIH-3T3 cells using MST2/STK3 Rabbit mAb (NBP3-16737) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: MST2/STK3 Antibody (5J1I4) [NBP3-16737] - Immunofluorescence analysis of NIH/3T3 cells using MST2/STK3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunocytochemistry/ Immunofluorescence: MST2/STK3 Antibody (5J1I4) [MST2/STK3] - Immunofluorescence analysis of NIH/3T3 cells using MST2/STK3 Rabbit mAb at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) at 1:500 dilution. Blue: DAPI for nuclear staining.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF
• Clone: 5J1I4
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MST2/STK3 Antibody (5J1I4) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 1-100 of human MST2/STK3 (Q13188). MEQPPAPKSKLKKLSEDSLTKQPEEVFDVLEKLGEGSYGSVFKAIHKESGQVVAIKQVPVESDLQEIIKEISIMQQCDSPYVVKYYGSYFKNTDLWIVME
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: STK3
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
  • Western Blot 1:500 - 1:1000
• Theoretical MW: 56 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MST2/STK3 Antibody (5J1I4)

• EC 2.7.11
• FLJ90748
• KRS1
• Mammalian STE20-like protein kinase 2
• Mess1
• MST2
• MST-2
• MST2EC 2.7.11.1
• MST3
• serine/threonine kinase 3 (STE20 homolog, yeast)
• serine/threonine kinase 3 (Ste20, yeast homolog)
• serine/threonine kinase 3
• serine/threonine-protein kinase 3
• Serine/threonine-protein kinase Krs-1
• STE20-like kinase MST2
• STK3

Background

Mammalian Sterile 20-Like 2 (Mst2) is most similar to the previously identified Mst1 protein kinase (78% identity, 88% similarity). Northern analysis indicates that MST2 mRNA is expressed at high levels in adult kidney, skeletal and placental tissues and at very low levels in adult heart, lung, liver and brain tissues. An in-vitro kinase assay indicates that Mst2 can phosphorylate an exogenous substrate, as well as itself, and phospho-amino-acid analysis indicates that it is a serine/threonine protein kinase (1) Mst2, a STE20-family member and purported Hpo ortholog, phosphorylates and activates both Lats1 and Lats2. Results indicate that Mst2-like kinases regulate Lats kinase activities in an evolutionarily conserved regulatory pathway (2). When stably expressed in HeLa cells, Mst highly sensitizes the cells to death receptor-mediated apoptosis by accelerating caspase-3 activation. These findings suggest that Mst1 and Mst2 play a role in apoptosis both upstream and downstream of caspase activation (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: STK3