MSANTD3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MSANTD3 Antibody [NBP2-57629] - Staining of human cell line RH-30 shows localization to nucleoplasm.

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MSANTD3 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: MNEVHVAKIQQIERECEMAEEEHRIKMEVLNKKKMYWERKLQTFTKEWPVSSFNRPFPNSP
Specificity
Specificity of human MSANTD3 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MSANTD3
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MSANTD3 Recombinant Protein Antigen (NBP2-57629PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for MSANTD3 Antibody

  • C9orf30
  • chromosome 9 open reading frame 30
  • FLJ34973
  • hypothetical protein LOC91283
  • L8
  • MGC17337
  • MSANTD3
  • Myb/SANT-like DNA-binding domain containing 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-2269
Species: Hu, Mu
Applications: WB, IHC, IHC-P, IP, KD
NBP3-05567
Species: Hu, Mu
Applications: WB, ICC/IF
NBP2-20216
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-81328
Species: Hu
Applications: WB, ICC/IF
NBP1-76549
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
H00029956-M01A
Species: Hu, Mu
Applications: WB, ELISA, IHC
NBP2-20214
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88582
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84037
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-31413
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82857
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00026156-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-84744
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-20210
Species: Hu, Mu, I
Applications: WB, IHC, IHC-P
NBP1-88446
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00058516-B02P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, KD
H00006124-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
NBP1-82853
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-57629
Species: Hu, Mu, Rt
Applications: ICC/IF

Publications for MSANTD3 Antibody (NBP2-57629) (0)

There are no publications for MSANTD3 Antibody (NBP2-57629).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MSANTD3 Antibody (NBP2-57629) (0)

There are no reviews for MSANTD3 Antibody (NBP2-57629). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MSANTD3 Antibody (NBP2-57629) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MSANTD3 Products

Bioinformatics Tool for MSANTD3 Antibody (NBP2-57629)

Discover related pathways, diseases and genes to MSANTD3 Antibody (NBP2-57629). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on MSANTD3

There are no specific blogs for MSANTD3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MSANTD3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MSANTD3