MS4A6A Antibody - Azide and BSA Free

Western Blot: MS4A6A Antibody [H00064231-B01P] - Analysis of MS4A6A expression in transfected 293T cell line by MS4A6A polyclonal antibody. Lane 1: MS4A6A transfected lysate(27.39 KDa). Lane 2: Non-transfected lysate.

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MS4A6A Antibody - Azide and BSA Free Summary

• Immunogen: MS4A6A (AAH22854, 1 a.a. - 248 a.a.) full-length human protein. MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS
• Specificity: MS4A6A - membrane-spanning 4-domains, subfamily A, member 6A,
• Isotype: IgG
• Clonality: Polyclonal
• Host: Mouse
• Gene: MS4A6A
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1:500
• Application Notes: Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.4)
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MS4A6A Antibody - Azide and BSA Free

• 4SPAN3
• CD20 antigen-like 3
• CD20L3
• CD20L3MS4A6A-polymorph
• CD20-like precusor
• CDA01
• Four-span transmembrane protein 3
• four-span transmembrane protein 3.1,4SPAN3.2
• four-span transmembrane protein 3.2
• HAIRB-iso
• membrane-spanning 4-domains subfamily A member 6A
• membrane-spanning 4-domains, subfamily A, member 6A
• MGC131944
• MGC22650
• MS4A6A
• MS4A6MST090
• MST090
• MSTP090

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MS4A6A
• Entrez:
  • 64231(Human)
• Uniprot:
  • AAH22854(Human)