MS4A6A Antibody

Images

 
Western Blot: MS4A6A Antibody [H00064231-B01P] - Analysis of MS4A6A expression in transfected 293T cell line by MS4A6A polyclonal antibody. Lane 1: MS4A6A transfected lysate(27.39 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MS4A6A Antibody Summary

Immunogen
MS4A6A (AAH22854, 1 a.a. - 248 a.a.) full-length human protein. MTSQPVPNETIIVPPSNVINFSQAEKPEPTNQGQDSLKKHLHAEIKVIGTIQILCGMMVLSLGIILASASFSPNFTQVTSTLLNSAYPFIGPFFFIISGSLSIATEKRLTKLLVHSSLVGSILSALSALVGFIILSVKQATLNPASLQCELDKNNIPTRSYVSYFYHDSLYTTDCYTAKASLAGSLSLMLICTLLEFCLAVLTAVLRWKQAYSDFPGSVLFLPHSYIGNSGMSSKMTHDCGYEELLTS
Specificity
MS4A6A - membrane-spanning 4-domains, subfamily A, member 6A,
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MS4A6A
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:500
Application Notes
Antibody reactive against Recombinant Protein with GST tag on ELISA and Western Blot and also on transfected lysate in western blot. GST tag alone is used as a negative control.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MS4A6A Antibody

  • 4SPAN3
  • CD20 antigen-like 3
  • CD20L3
  • CD20L3MS4A6A-polymorph
  • CD20-like precusor
  • CDA01
  • Four-span transmembrane protein 3
  • four-span transmembrane protein 3.1,4SPAN3.2
  • four-span transmembrane protein 3.2
  • HAIRB-iso
  • membrane-spanning 4-domains subfamily A member 6A
  • membrane-spanning 4-domains, subfamily A, member 6A
  • MGC131944
  • MGC22650
  • MS4A6A
  • MS4A6MST090
  • MST090
  • MSTP090

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. The gene encoding this protein is localized to 11q12.1, among a cluster of family members. Alternative splicing of this gene results in several transcript variants. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MS4A6A Antibody (H00064231-B01P) (0)

There are no publications for MS4A6A Antibody (H00064231-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A6A Antibody (H00064231-B01P) (0)

There are no reviews for MS4A6A Antibody (H00064231-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A6A Antibody (H00064231-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MS4A6A Products

Research Areas for MS4A6A Antibody (H00064231-B01P)

Find related products by research area.

Blogs on MS4A6A

There are no specific blogs for MS4A6A, but you can read our latest blog posts.
mFluor Violet Conjugated Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MS4A6A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MS4A6A
Entrez
Uniprot