MS4A3 Recombinant Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

MS4A3 Recombinant Protein Summary

Description
MS4A3 (Human) GST-Tagged Recombinant Protein (P02)

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MASHEVDNAELGSASAHGTPGSEAGPEELNTSVYQPIDGSPDYQKAKLQVLGAIQILNAAMILALGVFLGSLQYPYHFQKHFFFFTFYTGYPIWGAVFFCSSGTLSVVAGIKPTRTWIQNSFGMNIASATIALVGTAFLSLNIAVNIQSLRSCHSSSESPDLCNYMGSISNGMVSLLLILTLLELCVTISTIAMWCNANCCNSREEISSPPNSV
Gene
MS4A3

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Conjugate
Unconjugated
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Applications/Dilutions

Application Notes
Western blot, ELISA. This protein has not been tested for any functionality. This product may contain endotoxins and is not suitable for use with live cells.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MS4A3 Recombinant Protein

  • CD20 antigen homolog
  • CD20 antigen-like protein
  • CD20L
  • CD20LIgE receptor beta subunit
  • hematopoietic cell 4 transmembrane protein
  • Hematopoietic-specific transmembrane protein 4
  • HTM4
  • HTM4IgE receptor beta chain
  • membrane-spanning 4-domains subfamily A member 3
  • membrane-spanning 4-domains, subfamily A, member 3 (hematopoieticcell-specific)
  • MS4A3

Background

This gene encodes a member of the membrane-spanning 4A gene family. Members of this protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. This family member likely plays a role in signal transduction and may function as a subunit associated with receptor complexes. The gene encoding this protein is localized to 11q12, among a cluster of related family members. Alternative splicing may result in multiple transcript variants; however, not all variants have been fully described. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-43435
Species: Hu, Mu
Applications: WB, Flow
H00054474-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP2-37507
Species: Hu, Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
FAB7797P
Species: Hu
Applications: Flow
NBP2-01245
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-31807
Species: Hu
Applications: IHC, IHC-P
MAB8489
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-86496
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-31998
Species: Hu
Applications: IHC, IHC-P
NBP1-90895
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-31116
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-52926
Species: Hu
Applications: WB
NB600-1071
Species: Mu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
H00245802-P01
Species: Hu
NBP1-86540
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-33518
Species: Hu
Applications: WB, IHC, IHC-P
MAB4504
Species: Mu
Applications: Flow

Publications for MS4A3 Recombinant Protein (H00000932-P02) (0)

There are no publications for MS4A3 Recombinant Protein (H00000932-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MS4A3 Recombinant Protein (H00000932-P02) (0)

There are no reviews for MS4A3 Recombinant Protein (H00000932-P02). By submitting a review earn points towards our Rewards Program.
  • 250 points for product review
  • 500 additional points for an image with your product review
  • Double points (500) if you are the first to review this product
  • Double points (1000) if you are the first to review this product with an image

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MS4A3 Recombinant Protein (H00000932-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MS4A3 Recombinant Protein Products

Related Products by Gene

Bioinformatics Tool for MS4A3 Recombinant Protein (H00000932-P02)

Discover related pathways, diseases and genes to MS4A3 Recombinant Protein (H00000932-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MS4A3 Recombinant Protein (H00000932-P02)

Discover more about diseases related to MS4A3 Recombinant Protein (H00000932-P02).
 

Pathways for MS4A3 Recombinant Protein (H00000932-P02)

View related products by pathway.

PTMs for MS4A3 Recombinant Protein (H00000932-P02)

Learn more about PTMs related to MS4A3 Recombinant Protein (H00000932-P02).

Blogs on MS4A3

There are no specific blogs for MS4A3, but you can read our latest blog posts.

Contact Information

Product PDFs

Bioinformatics

Gene Symbol MS4A3
Entrez
Uniprot

Customer Resources

Novus Review - Submit your review and earn rewards points which can be used for merchandise & discounts.
Risk Free Testing - Test on a species/application not listed above to receive a full credit towards a future purchase.

Novus' Quality Guarantee - Novus guarantees that every product we sell will work in the application and species listed on our website and datasheets.

Submit your question on H00000932-P02 below.
During business hours, we will respond to your email within 24 hours. For any questions submitted on the weekend, a response will be received on Monday.
For immediate assistance during business hours M- F (excluding major holidays), please contact us.
Ask a Scientist - We have a lab full of white coats just waiting for your scientific questions and concerns.

Customers Who Bought This Also Bought

MS4A3 Recombinant Protein
H00000932-P01-2ug
MS4A3 Antibody
NBP1-86543
MS4A3 Antibody
NBP1-86543
MS4A3 Antibody
NBP1-86543