MRPS34 Antibody


Western Blot: MRPS34 Antibody [NBP1-82729] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunocytochemistry/ Immunofluorescence: MRPS34 Antibody [NBP1-82729] - Staining of human cell line U-2 OS shows positivity in mitochondria.
Immunohistochemistry-Paraffin: MRPS34 Antibody [NBP1-82729] - Staining of human stomach, lower shows strong granular cytoplasmic positivity in glandular cells.
Western Blot: MRPS34 Antibody [NBP1-82729] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MRPS34 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids: PEDSLASVPYPPLLRAMIIAERQKNGDTSTEEPMLNVQRIRMEPWDYPAKQEDKGRAKGT
Specificity of human, mouse, rat MRPS34 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 0.4 ug/ml
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPS34 Protein (NBP1-82729PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPS34 Antibody

  • MGC2616
  • mitochondrial ribosomal protein S34
  • MRPS12
  • MRP-S12,28S ribosomal protein S34, mitochondrial
  • MRP-S34
  • S34mt


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ICC/IF
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC
Species: Hu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt, Av, Ce
Applications: WB, ChIP, ICC/IF, IHC, IHC-P, IP, ChIP
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, ICC, KO
Species: Hu
Applications: WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P

Publications for MRPS34 Antibody (NBP1-82729) (0)

There are no publications for MRPS34 Antibody (NBP1-82729).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPS34 Antibody (NBP1-82729) (0)

There are no reviews for MRPS34 Antibody (NBP1-82729). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPS34 Antibody (NBP1-82729) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPS34 Products

Bioinformatics Tool for MRPS34 Antibody (NBP1-82729)

Discover related pathways, diseases and genes to MRPS34 Antibody (NBP1-82729). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPS34 Antibody (NBP1-82729)

Discover more about diseases related to MRPS34 Antibody (NBP1-82729).

Research Areas for MRPS34 Antibody (NBP1-82729)

Find related products by research area.

Blogs on MRPS34

There are no specific blogs for MRPS34, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPS34 Antibody and receive a gift card or discount.


Gene Symbol MRPS34