MRPL28 Antibody

Images

 
Western Blot: MRPL28 Antibody [NBP1-82805] - Lane 1: Marker [kDa] 230, 130, 95, 72, 56, 36, 28, 17, 11. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp
Immunocytochemistry/ Immunofluorescence: MRPL28 Antibody [NBP1-82805] - Immunofluorescent staining of human cell line U-2 OS shows localization to mitochondria.
Immunohistochemistry-Paraffin: MRPL28 Antibody [NBP1-82805] - Staining of human duodenum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MRPL28 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:RRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MRPL28
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:200-1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPL28 Protein (NBP1-82805PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (80%), Rat (81%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MRPL28 Antibody

  • L28mt
  • MAAT139S ribosomal protein L28, mitochondrial
  • Melanoma antigen p15
  • melanoma-associated antigen recognised by cytotoxic T lymphocytes
  • Melanoma-associated antigen recognized by T lymphocytes
  • MGC8499
  • mitochondrial ribosomal protein L28
  • MRP-L28
  • p15

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
MAB6798
Species: Hu
Applications: WB, ICC
NBP2-29463
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-46085
Species: Hu
Applications: WB, IHC
NBP1-87425
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2377
Species: Mu
Applications: WB, Simple Western, IHC
NBP2-15141
Species: Hu
Applications: WB
NBP1-80616
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-13387
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84745
Species: Hu
Applications: IHC, IHC-P
NBP2-47560
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-82454
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
AF2065
Species: Mu
Applications: WB, Simple Western, ICC
NBP1-87431
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80965
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-91776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-71687
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
NB200-103
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC

Publications for MRPL28 Antibody (NBP1-82805) (0)

There are no publications for MRPL28 Antibody (NBP1-82805).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL28 Antibody (NBP1-82805) (0)

There are no reviews for MRPL28 Antibody (NBP1-82805). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRPL28 Antibody (NBP1-82805) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MRPL28 Products

Bioinformatics Tool for MRPL28 Antibody (NBP1-82805)

Discover related pathways, diseases and genes to MRPL28 Antibody (NBP1-82805). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL28 Antibody (NBP1-82805)

Discover more about diseases related to MRPL28 Antibody (NBP1-82805).
 

Pathways for MRPL28 Antibody (NBP1-82805)

View related products by pathway.

Research Areas for MRPL28 Antibody (NBP1-82805)

Find related products by research area.

Blogs on MRPL28

There are no specific blogs for MRPL28, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MRPL28 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MRPL28