MRPL28 Antibody Summary
Immunogen |
This antibody was developed against Recombinant Protein corresponding to amino acids: RRAAIYDKYKEFAIPEEEAEWVGLTLEEAIEKQRLLEEKDPVPLFKIYVAELIQQLQQQALSEPAVVQKRASGQ |
Specificity |
Specificity of human MRPL28 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
Isotype |
IgG |
Clonality |
Polyclonal |
Host |
Rabbit |
Gene |
MRPL28 |
Purity |
Immunogen affinity purified |
Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
Dilutions |
- Western Blot 0.04-0.4 ug/ml
- Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:200 - 1:500
- Immunohistochemistry-Paraffin 1:200 - 1:500
|
Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (80%), Rat (81%)
Packaging, Storage & Formulations
Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Buffer |
PBS (pH 7.2) and 40% Glycerol |
Preservative |
0.02% Sodium Azide |
Purity |
Immunogen affinity purified |
Alternate Names for MRPL28 Antibody
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Mu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, ICC
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: WB, IHC
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, S-ELISA
Species: Mu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-P
Species: Hu
Applications: IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Publications for MRPL28 Antibody (NBP1-82805) (0)
There are no publications for MRPL28 Antibody (NBP1-82805).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPL28 Antibody (NBP1-82805) (0)
There are no reviews for MRPL28 Antibody (NBP1-82805).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPL28 Antibody (NBP1-82805) (0)
Secondary Antibodies
| |
Isotype Controls
|
Other Available Formats
Additional MRPL28 Products
Bioinformatics Tool for MRPL28 Antibody (NBP1-82805)
Discover related pathways, diseases and genes to MRPL28 Antibody (NBP1-82805). Need help?
Read the
Bioinformatics Tool Guide for instructions on using this tool.
Diseases for MRPL28 Antibody (NBP1-82805)
Discover more about diseases related to MRPL28 Antibody (NBP1-82805).
| | Pathways for MRPL28 Antibody (NBP1-82805)
View related products by pathway.
|
Research Areas for MRPL28 Antibody (NBP1-82805)
Find related products by research area.
|
Blogs on MRPL28