MRPL23 Antibody


Immunocytochemistry/ Immunofluorescence: MRPL23 Antibody [NBP2-30918] - Staining of human cell line PC-3 shows localization to nucleoli fibrillar center & mitochondria.
Immunohistochemistry: MRPL23 Antibody [NBP2-30918] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P

Order Details

MRPL23 Antibody Summary

This antibody was developed against a recombinant protein corresponding to amino acids: KRRDHRNVRIKKPDYKVAYVQLAHGQTFTFPDLFPEKDESPEGSAADDLYSMLEEERQQRQSSDPRRGGVPSWFGL
Specificity of human MRPL23 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:500 - 1:1000
  • Immunohistochemistry-Paraffin 1:500 - 1:1000
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRPL23 Protein (NBP2-30918PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRPL23 Antibody

  • FLJ45387
  • L23MRPmitochondrial
  • mitochondrial ribosomal protein L23


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, ELISA
Species: Hu, Mu
Applications: WB, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt, Ye, Xp(-)
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, KD
Species: Hu, Mu
Applications: WB, IHC
Species: Hu
Applications: WB (-), IP
Species: Hu, Rt
Applications: WB, IHC, IHC-Fr, IHC-P, IP
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA
Species: Hu, Rt
Applications: WB, ICC/IF
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for MRPL23 Antibody (NBP2-30918) (0)

There are no publications for MRPL23 Antibody (NBP2-30918).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRPL23 Antibody (NBP2-30918) (0)

There are no reviews for MRPL23 Antibody (NBP2-30918). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MRPL23 Antibody (NBP2-30918) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRPL23 Products

Bioinformatics Tool for MRPL23 Antibody (NBP2-30918)

Discover related pathways, diseases and genes to MRPL23 Antibody (NBP2-30918). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRPL23 Antibody (NBP2-30918)

Discover more about diseases related to MRPL23 Antibody (NBP2-30918).

Pathways for MRPL23 Antibody (NBP2-30918)

View related products by pathway.

PTMs for MRPL23 Antibody (NBP2-30918)

Learn more about PTMs related to MRPL23 Antibody (NBP2-30918).

Blogs on MRPL23

There are no specific blogs for MRPL23, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRPL23 Antibody and receive a gift card or discount.


Gene Symbol MRPL23