MRPL21 Antibody - BSA Free Summary
| Description |
Novus Biologicals Rabbit MRPL21 Antibody - BSA Free (NBP2-13612) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee. |
| Immunogen |
This antibody was developed against a recombinant protein corresponding to the amino acids: ACSHSILRPSGPGAASLWSASRRFNSQSTSYLPGYVPKTSLSSPPWPEVVLPDPVEETRHHAEVV |
| Isotype |
IgG |
| Clonality |
Polyclonal |
| Host |
Rabbit |
| Gene |
MRPL21 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
- Immunohistochemistry 1:50 - 1:200
- Immunohistochemistry-Paraffin 1:50 - 1:200
- Western Blot 0.04-0.4 ug/ml
|
| Application Notes |
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. |
| Control Peptide |
|
Reactivity Notes
Immunogen displays the following percentage of sequence identity for non-tested species: Mouse (83%), Rat (82%)
Packaging, Storage & Formulations
| Storage |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.2) and 40% Glycerol |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MRPL21 Antibody - BSA Free
Background
Belonging to the ribosomal protein L21P family, MRPL21 plays an important role in translation and RNA binding. These Mammalian mitochondrial ribosomal proteins contain a small 28S subunit and a large 39S subunit, and consist of 75% protein to rRNA composition. The ribosomal proteins also help in protein synthesis within the mitochondrion. This gene also acts as a structural component of mitochondrial ribosomes, and encodes the 39S subunit protein.
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Ca, Hu, Pm, Mu, Rt
Applications: IHC, IHC-P, WB
Species: Bv, Ca, Ch, Hu, Mu, Pm
Applications: ICC/IF, IP, WB
Species: Hu
Applications: IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
Species: Hu
Applications: CyTOF-ready, Flow, IHC
Species: Hu
Applications: WB
Species: Hu, Pm, Pm
Applications: Flow (-), Flow, ICC/IF (-), ICC/IF, IHC, IHC-P, IP (-), IP, WB (-), WB
Species: Hu
Applications: IHC, IHC-P
Species: Hu, Pm
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
Species: Ce, Hu
Applications: IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: IHC, IHC-P, WB
Species: Mu
Applications: CyTOF-ready, Flow, IHC, WB
Species: Hu, Mu
Applications: ELISA, ICC/IF, WB
Species: Hu
Applications: WB, ICC/IF, IHC
Publications for MRPL21 Antibody (NBP2-13612) (0)
There are no publications for MRPL21 Antibody (NBP2-13612).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MRPL21 Antibody (NBP2-13612) (0)
There are no reviews for MRPL21 Antibody (NBP2-13612).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MRPL21 Antibody (NBP2-13612) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MRPL21 Products
Blogs on MRPL21