MRG15 Antibody - BSA Free

Western Blot: MRG15 Antibody [NBP3-38377] - Western blot analysis of various lysates using MRG15 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Enhanced Kit.Exposure time: 90s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ELISA
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRG15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRG15 Antibody - BSA Free (NBP3-38377) is a polyclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human MRG15 (NP_006782.1).
  
  Sequence:
  MAPKQDPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQKANQEQYAEGKMRGAAPGKKTSG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MORF4L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 41 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRG15 Antibody - BSA Free

• Eaf3
• Esa1p-associated factor 3 homolog
• HsT17725
• MEAF3
• MGC10631
• MORF-related gene on chromosome 15
• MORFRG15
• mortality factor 4 like 1
• mortality factor 4-like protein 1
• MRG15MORF-related gene 15 protein
• Protein MSL3-1
• S863-6
• Transcription factor-like protein MRG15

Background

MRG15 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MORF4L1