MRG15 Antibody - BSA Free

Western Blot: MRG15 Antibody [NBP2-56097] - Western blot analysis in human cell line RT-4 and human cell line U-251 MG.

Immunocytochemistry/Immunofluorescence: MRG15 Antibody [NBP2-56097] - Staining of human cell line RH-30 shows localization to nuclear speckles.

ChIP-Exo-Seq composite graph for Anti-MORF4L1 (NBP2-56097) tested in K562 cells. Strand-specific reads (blue: forward, red: reverse) and IgG controls (black: forward, grey: reverse) are plotted against the distance from a composite set of reference binding sites. The antibody exhibits robust target enrichment compared to a non-specific IgG control and precisely reveals its structural organization around the binding site. Data generated by Prof. B. F. Pugh´s Lab at Cornell University.

• Reactivity: Hu, Mu, Rt
• Applications: WB, ICC/IF
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MRG15 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MRG15 Antibody - BSA Free (NBP2-56097) is a polyclonal antibody validated for use in WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: QKANQEQYAEGKMRGAAPGKKTSGLQQKNVEVKTKKNKQK
• Predicted Species: Mouse (100%), Rat (100%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MORF4L1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Western Blot 0.04-0.4 ug/ml
• Application Notes: ICC/IF, Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  MRG15 Recombinant Protein Antigen (NBP2-56097PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MRG15 Antibody - BSA Free

• Eaf3
• Esa1p-associated factor 3 homolog
• HsT17725
• MEAF3
• MGC10631
• MORF-related gene on chromosome 15
• MORFRG15
• mortality factor 4 like 1
• mortality factor 4-like protein 1
• MRG15MORF-related gene 15 protein
• Protein MSL3-1
• S863-6
• Transcription factor-like protein MRG15

Background

MRG15 is a component of the NuA4 histone acetyltransferase (HAT) complex which is involved in transcriptional activation of select genes principally by acetylation of nucleosomal histones H4 and H2A. This modification may both alter nucleosome - DNA interactions and

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MORF4L1