MRG15 Antibody


Western Blot: MRG15 Antibody [NBP1-84937] - Lane 1: Mouse liver tissue lysate Lane 2: Rat liver tissue lysate
Immunohistochemistry-Paraffin: MRG15 Antibody [NBP1-84937] - Staining of human testis shows nuclear positivity in seminiferous ducts.
Western Blot: MRG15 Antibody [NBP1-84937] - Lane 1: Marker [kDa] 250, 130, 95, 72, 55, 36, 28, 17, 10. Lane 2: Human cell line RT-4. Lane 3: Human cell line U-251MG sp. Lane 4: Human plasma (IgG/HSA depleted). Lane more

Product Details

Reactivity Hu, Mu, RtSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P

Order Details

MRG15 Antibody Summary

This antibody was developed against Recombinant Protein corresponding to amino acids:DPKPKFQEGERVLCFHGPLLYEAKCVKVAIKDKQVKYFIHYSGWNKNWDEWVPESRVLKYVDTNLQKQRELQ
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Predicted Species
Rat (99%). Backed by our 100% Guarantee.
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MRG15 Protein (NBP1-84937PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Immunogen affinity purified

Alternate Names for MRG15 Antibody

  • Eaf3
  • Esa1p-associated factor 3 homolog
  • HsT17725
  • MEAF3
  • MGC10631
  • MORF-related gene on chromosome 15
  • MORFRG15
  • mortality factor 4 like 1
  • mortality factor 4-like protein 1
  • MRG15MORF-related gene 15 protein
  • Protein MSL3-1
  • S863-6
  • Transcription factor-like protein MRG15


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu
Applications: WB, Simple Western, IHC-P
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, IHC-Fr, IHC-P
Species: Hu
Applications: ICC/IF
Species: Hu, Mu, Rt, Xp, Ye
Applications: WB, ChIP, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Ch
Applications: WB, ChIP, IP
Species: Hu
Species: Hu
Applications: WB, Simple Western, IHC
Species: Hu
Applications: WB, ELISA, Flow, IHC, IHC-P, CyTOF-ready, ICC, IF
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Applications: ICC/IF, IHC, IHC-P
Species: Hu
Species: Hu, Mu, Rt, Ma
Applications: WB, ChIP, DB, ICC/IF
Species: Hu
Species: Hu
Species: Hu
Species: Hu
Applications: ELISA, ICC/IF
Species: Hu

Publications for MRG15 Antibody (NBP1-84937) (0)

There are no publications for MRG15 Antibody (NBP1-84937).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRG15 Antibody (NBP1-84937) (0)

There are no reviews for MRG15 Antibody (NBP1-84937). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MRG15 Antibody (NBP1-84937) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Additional MRG15 Products

Bioinformatics Tool for MRG15 Antibody (NBP1-84937)

Discover related pathways, diseases and genes to MRG15 Antibody (NBP1-84937). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRG15 Antibody (NBP1-84937)

Discover more about diseases related to MRG15 Antibody (NBP1-84937).

Pathways for MRG15 Antibody (NBP1-84937)

View related products by pathway.

PTMs for MRG15 Antibody (NBP1-84937)

Learn more about PTMs related to MRG15 Antibody (NBP1-84937).

Blogs on MRG15

There are no specific blogs for MRG15, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MRG15 Antibody and receive a gift card or discount.


Gene Symbol MORF4L1