MRCK Recombinant Protein Antigen

Images

 
There are currently no images for MRCK Recombinant Protein Antigen (NBP2-55964PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MRCK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRCK.

Source: E.coli

Amino Acid Sequence: TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC42BPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This peptide is useful as a blocking peptide for NBP2-55964 The protein was purified by IMAC chromatography and the expected concentration is greater than 0.5 mg/ml. This protein is produced on demand, estimated shipping date is 4 weeks after the order is placed. For further blocking peptide related information and a protocol, click here.
Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Alternate Names for MRCK Recombinant Protein Antigen

  • CDC42 binding protein kinase alpha (DMPK-like)
  • CDC42 binidng protein kinase beta
  • CDC42-binding protein kinase alpha (DMPK-like)
  • CDC42-binding protein kinase alpha
  • DMPK-like alpha
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0451DKFZp686L1738
  • MRCK alpha
  • MRCK
  • MRCKADKFZp686P1738
  • Myotonic dystrophy kinase-related CDC42-binding kinase alpha
  • myotonic dystrophy kinase-related CDC42-binding protein kinase alpha
  • Myotonic dystrophy protein kinase-like alpha
  • PK428FLJ23347
  • serine/threonine-protein kinase MRCK alpha
  • ser-thr protein kinase PK428
  • ser-thr protein kinase related to the myotonic dystrophy protein kinase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85010
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-14907
Species: Mu, Rt
Applications: WB, IHC, IHC-P
NBP2-25159
Species: Hu, Mu, Rt, Po, Bv, Eq
Applications: WB, ICC/IF, IHC
NBP1-58359
Species: Hu
Applications: WB, IHC, IHC-P
NB100-56159
Species: Hu, Mu, Rt, Ca
Applications: WB, IHC, IHC-P, IP
NBP1-80073
Species: Hu, Rt
Applications: WB, IHC, IHC-P
AF887
Species: Hu, Mu, Rt
Applications: WB, Simple Western, IHC, CyTOF-ready, ICFlow
H00009578-M03
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-85802
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
MAB4470
Species: Multi
Applications: WB, IHC, ICC
NB100-79840
Species: Hu
Applications: WB (-), IP
NB110-68136
Species: Hu, Mu, Rt, Fe
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, CyTOF-ready, Flow-IC
AF2584
Species: Mu
Applications: WB, Simple Western
NBP2-67599
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-30249
Species: Hu, Mu, Rt, Xp
Applications: WB, ELISA, Flow, ICC/IF
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-IC
NBP1-84072
Species: Hu
Applications: IHC, IHC-P
NBP2-62682
Species: Hu
Applications: IHC, IHC-P

Publications for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no publications for MRCK Recombinant Protein Antigen (NBP2-55964PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no reviews for MRCK Recombinant Protein Antigen (NBP2-55964PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

FAQs for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Array Products

Bioinformatics Tool for MRCK Recombinant Protein Antigen (NBP2-55964PEP)

Discover related pathways, diseases and genes to MRCK Recombinant Protein Antigen (NBP2-55964PEP). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MRCK Recombinant Protein Antigen (NBP2-55964PEP)

Discover more about diseases related to MRCK Recombinant Protein Antigen (NBP2-55964PEP).
 

Pathways for MRCK Recombinant Protein Antigen (NBP2-55964PEP)

View related products by pathway.

PTMs for MRCK Recombinant Protein Antigen (NBP2-55964PEP)

Learn more about PTMs related to MRCK Recombinant Protein Antigen (NBP2-55964PEP).
 

Research Areas for MRCK Recombinant Protein Antigen (NBP2-55964PEP)

Find related products by research area.

Blogs on MRCK

There are no specific blogs for MRCK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

MRCK Antibody
NBP2-55964

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRCK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42BPA