MRCK Recombinant Protein Antigen

Images

 
There are currently no images for MRCK Recombinant Protein Antigen (NBP2-55964PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MRCK Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MRCK.

Source: E. coli

Amino Acid Sequence: TRRESQSEREEFESEFKQQYEREKVLLTEENKKLTSELDKLTTLYENLSIHNQQLEEEVKD

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
CDC42BPA
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-55964.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
25 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MRCK Recombinant Protein Antigen

  • CDC42 binding protein kinase alpha (DMPK-like)
  • CDC42 binidng protein kinase beta
  • CDC42-binding protein kinase alpha (DMPK-like)
  • CDC42-binding protein kinase alpha
  • DMPK-like alpha
  • EC 2.7.11
  • EC 2.7.11.1
  • KIAA0451DKFZp686L1738
  • MRCK alpha
  • MRCK
  • MRCKADKFZp686P1738
  • Myotonic dystrophy kinase-related CDC42-binding kinase alpha
  • myotonic dystrophy kinase-related CDC42-binding protein kinase alpha
  • Myotonic dystrophy protein kinase-like alpha
  • PK428FLJ23347
  • serine/threonine-protein kinase MRCK alpha
  • ser-thr protein kinase PK428
  • ser-thr protein kinase related to the myotonic dystrophy protein kinase

Background

MRCK is encoded by this gene is a member of the Serine/Threonine protein kinase family. This kinase contains multiple functional domains. Its kinase domain is highly similar to that of the myotonic dystrophy protein kinase (DMPK). This kinase also contains a Rac interactive binding (CRIB) domain, and has been shown to bind CDC42. It may function as a CDC42 downstream effector mediating CDC42 induced peripheral actin formation, and promoting cytoskeletal reorganization. Multiple alternatively spliced transcript variants have been described, and the full-length nature of two of them has been reported.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85010
Species: Hu
Applications: IHC,  IHC-P
NBP2-67895
Species: Hu, Mu, Rt
Applications: Flow, IHC,  IHC-P, IP, WB
NBP2-25160
Species: Bv, Ca, Eq, Hu, Mu, Po, Rt
Applications: ICC/IF, IHC, WB
NBP1-58359
Species: Hu
Applications: IHC,  IHC-P, WB
NB100-56159
Species: Ca, Hu, Mu, Rt
Applications: IHC,  IHC-P, IP, WB
NBP1-81555
Species: Hu
Applications: IHC,  IHC-P, WB
AF887
Species: Hu, Mu, Rt
Applications: CyTOF-ready, IHC, ICFlow, Simple Western, WB
NBP1-81440
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NBP1-85802
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
MAB4470
Species: All-Multi
Applications: Flow, ICC, IHC, WB
NBP1-83021
Species: Hu
Applications: IHC,  IHC-P
NB110-68136
Species: Fe, Hu, Mu, Rt
Applications: CyTOF-ready, ELISA, Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, WB
NBP2-52490
Species: Hu
Applications: CyTOF-ready, ELISA, Flow, WB
NBP1-85541
Species: Hu, Mu
Applications: IHC, IHC-Fr,  IHC-P, WB
NB100-524
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-Fr,  IHC-P, IP, WB
NBP2-38938
Species: Hu
Applications: IHC,  IHC-P
NBP2-62682
Species: Hu
Applications: IHC,  IHC-P

Publications for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no publications for MRCK Recombinant Protein Antigen (NBP2-55964PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no reviews for MRCK Recombinant Protein Antigen (NBP2-55964PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MRCK Recombinant Protein Antigen (NBP2-55964PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MRCK Products

Array NBP2-55964PEP

Research Areas for MRCK Recombinant Protein Antigen (NBP2-55964PEP)

Find related products by research area.

Blogs on MRCK

There are no specific blogs for MRCK, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MRCK Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol CDC42BPA