MR1 Antibody (5B5)

Images

 
Immunocytochemistry/ Immunofluorescence: MR1 Antibody (5B5) [H00003140-M04] - Analysis of monoclonal antibody to MR1 on HeLa cell. Antibody concentration 10 ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, ICC/IF
Clone
5B5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MR1 Antibody (5B5) Summary

Immunogen
MR1 (NP_001522 201 a.a. - 300 a.a.) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. TEPPLVRVNRKETFPGVTALFCKAHGFYPPEIYMTWMKNGEEIVQEIDYGDILPSGDGTYQAWASIELDPQSSNLYSCHVEHCGVHMVLQVPQESETIPL
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MR1
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
  • Immunocytochemistry/Immunofluorescence
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MR1 Antibody (5B5)

  • Class I histocompatibility antigen-like protein
  • FLJ31593
  • H2ls
  • HLALS
  • major histocompatibility complex class I-related gene protein
  • major histocompatibility complex, class I-like sequence
  • major histocompatibility complex, class I-related
  • MHC class I-like antigen MR-1
  • MHC class I-related gene protein
  • MHC class-I related-gene protein
  • MR1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

DDX0131P-100
Species: Hu
Applications: Flow, Func, ICC/IF, IHC, IHC-Fr, IHC-P
AF-386-PB
Species: Hu
Applications: WB, Flow, CyTOF-ready, ICC
MAB140
Species: Hu
Applications: Flow, IHC, CyTOF-ready, ELISA(Cap), ELISA(Det), Neut, ELISA(Sta)
NBP1-19371
Species: Hu, Mu, Rt, Ca, Rb
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF231
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready, ELISA(Cap), ELISA(Det), ICC, ELISA(Sta)
NB120-6405
Species: Rt
Applications: B/N, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, CyTOF-ready, Flow-IC
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
NB100-524
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
H00003117-M01
Species: Hu
Applications: WB, ELISA, PLA
MAB342
Species: Hu
Applications: WB, AgAct
NBP2-46123
Species: Hu
Applications: WB, IHC, IHC-P, IF
MAB7446
Species: Hu
Applications: Flow, CyTOF-ready
NB100-64852
Species: Hu
Applications: Flow, IHC, IHC-Fr

Publications for MR1 Antibody (H00003140-M04) (0)

There are no publications for MR1 Antibody (H00003140-M04).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MR1 Antibody (H00003140-M04) (0)

There are no reviews for MR1 Antibody (H00003140-M04). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for MR1 Antibody (H00003140-M04) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MR1 Products

Bioinformatics Tool for MR1 Antibody (H00003140-M04)

Discover related pathways, diseases and genes to MR1 Antibody (H00003140-M04). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MR1 Antibody (H00003140-M04)

Discover more about diseases related to MR1 Antibody (H00003140-M04).
 

Pathways for MR1 Antibody (H00003140-M04)

View related products by pathway.

PTMs for MR1 Antibody (H00003140-M04)

Learn more about PTMs related to MR1 Antibody (H00003140-M04).

Blogs on MR1

There are no specific blogs for MR1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MR1 Antibody (5B5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MR1
Entrez
Uniprot