MPPED2 Antibody (4H5)

Images

 
Western Blot: MPPED2 Antibody (4H5) [H00000744-M08] - Analysis of MPPED2 expression in IMR-32.
Western Blot: MPPED2 Antibody (4H5) [H00000744-M08] - Analysis of MPPED2 expression in transfected 293T cell line by MPPED2 monoclonal antibody (M08), clone 4H5. Lane 1: MPPED2 transfected lysatE (33.4 KDa). Lane 2: ...read more

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4H5
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MPPED2 Antibody (4H5) Summary

Immunogen
MPPED2 (AAH31582, 1 a.a. - 294 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MAHGIPSQGKVTITVDEYSSNPTQAFTHYNINQSRFQPPHVHMVDPIPYDTPKPAGHTRFVCISDTHSRTDGIQMPYGDILLHTGDFTELGLPSEVKKFNDWLGNLPYEYKIVIAGNHELTFDKEFMADLVKQDYYRFPSVSKLKPEDFDNVQSLLTNSIYLQDSEVTVKGFRIYGAPWTPWFNGWGFNLPRGQSLLDKWNLIPEGIDILMTHGPPLGFRDWVPKELQRVGCVELLNTVQRRVRPKLHVFGGIHEGYGIMTDGYTTYINASTCTVSFQPTNPPIIFDLPNPQGS
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MPPED2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MPPED2 Antibody (4H5)

  • 239FBchromosome 11 open reading frame 8
  • C11orf8dJ1024C24.1
  • D11S302E
  • dJ873F21.1
  • EC 3.1
  • FAM1B
  • Fetal brain protein 239
  • metallophosphoesterase domain containing 2
  • Metallophosphoesterase domain-containing protein 2
  • metallophosphoesterase MPPED2

Background

This gene likely encodes a metallophosphoesterase. The encoded protein may play a role a brain development. Alternatively spliced transcript variants have been described. The unprocessed precursor is 294 amino acids in length and has a predicted molecular weight of 33.6KDa. It belongs to the UPF0046 familly and is predominantly expressed in fetal brain.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-83701
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-91258
Species: Hu, Mu
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP1-87066
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB300-750
Species: Hu, Mu, Rt, Mk, Pm, Sh
Applications: WB, ICC/IF, IP
NBP1-81838
Species: Hu, Mu
Applications: WB, IHC, IHC-P
NBP1-92038
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-40364
Species: Hu
Applications: WB, IHC, IP
NBP2-57012
Species: Hu
Applications: ICC/IF
NBP1-86440
Species: Hu
Applications: IHC, IHC-P
NB100-2387
Species: Hu, Mu, Ze
Applications: WB, ICC/IF
NB300-549
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-97494
Species: Hu, Mu, Rt, Bv, Ch
Applications: WB, ICC/IF, IHC, IHC-P
NB100-87011
Species: Hu
Applications: WB, IP
H00000744-M08
Species: Hu
Applications: WB, ELISA

Publications for MPPED2 Antibody (H00000744-M08) (0)

There are no publications for MPPED2 Antibody (H00000744-M08).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MPPED2 Antibody (H00000744-M08) (0)

There are no reviews for MPPED2 Antibody (H00000744-M08). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MPPED2 Antibody (H00000744-M08) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MPPED2 Products

Bioinformatics Tool for MPPED2 Antibody (H00000744-M08)

Discover related pathways, diseases and genes to MPPED2 Antibody (H00000744-M08). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MPPED2 Antibody (H00000744-M08)

Discover more about diseases related to MPPED2 Antibody (H00000744-M08).
 

Pathways for MPPED2 Antibody (H00000744-M08)

View related products by pathway.

Research Areas for MPPED2 Antibody (H00000744-M08)

Find related products by research area.

Blogs on MPPED2

There are no specific blogs for MPPED2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MPPED2 Antibody (4H5) and receive a gift card or discount.

Bioinformatics

Gene Symbol MPPED2
Uniprot