![Immunohistochemistry-Paraffin: MPND Antibody [NBP2-30571] - Staining of human duodenum shows strong cytoplasm granular positivity in glandular cells.](http://images.novusbio.com/fullsize/MPND-Antibody-Immunohistochemistry-Paraffin-NBP2-30571-img0004.jpg "Immunohistochemistry-Paraffin: MPND Antibody [NBP2-30571] - Staining of human duodenum shows strong cytoplasm granular positivity in glandular cells.")
| Reactivity | HuSpecies Glossary |
| Applications | IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against a recombinant protein corresponding to amino acids: FHSHLTRSEVVGYLGGRWDVNSQMLTVLRAFPCRSRLGDAETAAAIEEEIYQSLFLRGLSLVGW |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MPND |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
![Immunohistochemistry-Paraffin: MPND Antibody [NBP2-30571] - Staining of human cerebellum shows strong cytoplasm granular positivity in Purkinje cells.](http://images.novusbio.com/fullsize/MPND-Antibody-Immunohistochemistry-Paraffin-NBP2-30571-img0002.jpg "Immunohistochemistry-Paraffin: MPND Antibody [NBP2-30571] - Staining of human cerebellum shows strong cytoplasm granular positivity in Purkinje cells.")
![Immunohistochemistry-Paraffin: MPND Antibody [NBP2-30571] - Staining of human cerebral cortex shows strong cytoplasm granular positivity in neurons.](http://images.novusbio.com/fullsize/MPND-Antibody-Immunohistochemistry-Paraffin-NBP2-30571-img0003.jpg "Immunohistochemistry-Paraffin: MPND Antibody [NBP2-30571] - Staining of human cerebral cortex shows strong cytoplasm granular positivity in neurons.")
![Immunohistochemistry-Paraffin: MPND Antibody [NBP2-30571] - Staining of human placenta shows strong cytoplasm granular positivity in in trophoblastic cells.](http://images.novusbio.com/fullsize/MPND-Antibody-Immunohistochemistry-Paraffin-NBP2-30571-img0005.jpg "Immunohistochemistry-Paraffin: MPND Antibody [NBP2-30571] - Staining of human placenta shows strong cytoplasm granular positivity in in trophoblastic cells.")
![Western Blot Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/Jak1_MAB4260_Western_Blot_6164.jpg)
![Simple Western Jak1 Antibody (413104) [Unconjugated]](https://images.novusbio.com/images2/mab4260_human-mouse-rat-jak1-mab-clone-413104-simple-western-299202214186.jpg)
![Western Blot Osteoactivin/GPNMB Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteoactivin_AF2550_Western_Blot_19926.jpg)
![Immunohistochemistry Osteoactivin/GPNMB Antibody [Unconjugated]](https://images.novusbio.com/images2/Osteoactivin_AF2550_Immunohistochemistry_15337.jpg)
![Knockdown Validated Osteoactivin/GPNMB Antibody [Unconjugated]](https://images.novusbio.com/images/af2550_human-osteoactivin-gpnmb-affinity-purified-polyclonal-ab-61220241239347.png)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/DATA_IL6_M6000_ELISA_936.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images2/IL-6_M6000_ELISA_415.jpg)
![N/A IL-6 [HRP]](https://images.novusbio.com/images/m6000b_mouse-il-6-quantikine-elisa-kit-44202415433118.jpg)
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")