Morg1 Antibody (4E12)

Images

 
Western Blot: Morg1 Antibody (4E12) [H00084292-M02] - Analysis of MORG1 expression in transfected 293T cell line by MORG1 monoclonal antibody (M02), clone 4E12.Lane 1: MORG1 transfected lysate (Predicted MW: 34.3 ...read more
Immunocytochemistry/ Immunofluorescence: Morg1 Antibody (4E12) [H00084292-M02] - Analysis of monoclonal antibody to MORG1 on HeLa cell . Antibody concentration 10 ug/ml.
Sandwich ELISA: Morg1 Antibody (4E12) [H00084292-M02] - Detection limit for recombinant GST tagged MORG1 is 1 ng/ml as a capture antibody.

Product Details

Summary
Reactivity Hu, MuSpecies Glossary
Applications WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA
Clone
4E12
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

Morg1 Antibody (4E12) Summary

Immunogen
MORG1 (NP_115708, 171 a.a. ~ 262 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. VDGRVRRYDLRMGQLFSDYVGSPITCTCFSRDGQCTLVSSLDSTLRLLDKDTGELLGEYKGHKNQEYKLDCCLSERDTHVVSCSEDGKVFFW
Specificity
MORG1 - mitogen-activated protein kinase organizer 1 (4E12)
Isotype
IgG2a Kappa
Clonality
Monoclonal
Host
Mouse
Gene
WDR83
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA
  • Immunocytochemistry/Immunofluorescence
  • Immunohistochemistry
  • Immunohistochemistry-Frozen
  • Sandwich ELISA
  • Western Blot 1:500
Application Notes
Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Publications
Read Publication using H00084292-M02.

Reactivity Notes

Human. Mouse reactivity reported in scientific literature (PMID: 22982595)

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
In 1x PBS, pH 7.4
Preservative
No Preservative
Purity
IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Morg1 Antibody (4E12)

  • MAPK organizer 1
  • MGC4238
  • MORG1Mitogen-activated protein kinase organizer 1
  • WD repeat domain 83
  • WD repeat domain-containing protein 83

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB100-139
Species: Hu, Mu, Rt
Applications: EM, ICC/IF, IHC, IHC-P, IP, KD, MS, WB
NB100-105
Species: Bv, Ca, Fe, Ma, Hu, Pm, Mu, Po, Pm, Rb, Rt, Sh, Xp
Applications: ChIP, ELISA, Flow, GS, IA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, In vitro, KD, KO, LA, PLA, Simple Western, TCS, WB
MEP00B
Species: Mu
Applications: ELISA
AF467
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
NBP2-67360
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, IP, KO, WB
NBP3-06477
Species: Hu
Applications: ICC/IF, IP, WB
DAN00
Species: Hu
Applications: ELISA
DVE00
Species: Hu
Applications: ELISA
NBP1-50631
Species: Hu, Mu
Applications: ICC/IF, IHC, IHC-P, Simple Western, WB
DIP100
Species: Hu
Applications: ELISA
NBP2-80467
Species: Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
MAB4540
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP1-82648
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP3-12487
Species: Hu, Mu, Rt
Applications: ELISA, IHC, IHC-P, WB
NBP1-81729
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NBP2-13967
Species: Hu
Applications: IHC, IHC-P, WB
AF1056
Species: Rt
Applications: IHC, WB
H00084292-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, S-ELISA

Publications for Morg1 Antibody (H00084292-M02)(1)

We have publications tested in 1 confirmed species: Mouse.


Filter By Application
All Applications
Filter By Species
Mouse
(1)
All Species

Reviews for Morg1 Antibody (H00084292-M02) (0)

There are no reviews for Morg1 Antibody (H00084292-M02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for Morg1 Antibody (H00084292-M02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Morg1 Products

Bioinformatics Tool for Morg1 Antibody (H00084292-M02)

Discover related pathways, diseases and genes to Morg1 Antibody (H00084292-M02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Morg1 Antibody (H00084292-M02)

Discover more about diseases related to Morg1 Antibody (H00084292-M02).
 

Pathways for Morg1 Antibody (H00084292-M02)

View related products by pathway.

Research Areas for Morg1 Antibody (H00084292-M02)

Find related products by research area.

Blogs on Morg1

There are no specific blogs for Morg1, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Morg1 Antibody (4E12) and receive a gift card or discount.

Bioinformatics

Gene Symbol WDR83
Entrez
Uniprot