Mohawk homeobox Antibody - BSA Free

Western Blot: Mohawk homeobox Antibody [NBP3-10446] - Western blot analysis of Mohawk homeobox in Mouse Liver lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Mu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

Mohawk homeobox Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Mohawk homeobox (NP_808263). Peptide sequence SNEFEEELVSPSSSETEGTFVYRTDTPDIGSTKGDSAANRRGPSKDDTYW
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MKX
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 38 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for Mohawk homeobox Antibody - BSA Free

• C10orf48
• homeobox protein Mohawk
• IFRX
• Iroquois family related homeodomain protein
• iroquois homeobox protein-like 1
• IRXL1chromosome 10 open reading frame 48
• MGC39616
• mohawk homeobox

Background

MKX is a member of an Iroquois (IRX) family-related class of 'three-amino acid loop extension' (TALE)atypical homeobox proteins characterized by 3 additional amino acids in the loop region between helix I and helix IIof the homeodomain (Anderson et al., 2006 (PubMed 16408284)).(supplied by OMIM)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MKX