Recombinant Human MOGAT3 GST (N-Term) Protein

Images

 
12.5% SDS-PAGE Stained with Coomassie Blue.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA, AP

Order Details

Recombinant Human MOGAT3 GST (N-Term) Protein Summary

Description
A recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 341 of Human MOGAT3 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence: MGVATTLQPPTTSKTLQKQHLEAVGAYQYVLTFLFMGPFFSLLVFVLLFTSLWPFSVFYLVWLYVDWDTPNQGGRRSEWIRNRAIWRQLRDYYPVKLVKTAELPPDRNYVLGAHPHGIMCTGFLCNFSTESNGFSQLFPGLRPWLAVLAGLFYLPVYRDYIMSFGLCPVSRQSLDFILSQPQLGQAVVIMVGGAHEALYSVPGEHCLTLQKRKGFVRLALRHGASLVPVYSFGENDIFRLKAFATGSWQHWCQLTFKKLMGFSPCIFWGRGLFSATSWGLLPFAVPITTVVGRPIPVPQRLHPTEEEVNHYHALYMTALEQLFEEHKESCGVPASTCLTFI

Preparation
Method
in vitro wheat germ expression system
Details of Functionality
This protein was produced in an in vitro wheat germ expression system that should preserve correct conformational folding that is necessary for biological function. While it is possible that this protein could display some level of activity, the functionality of this protein has not been explicitly measured or validated.
Source
Wheat germ
Protein/Peptide Type
Full Length Recombinant Protein
Gene
MOGAT3
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • ELISA
  • Immunoaffinity Purification
  • Protein Array
  • Western Blot
Theoretical MW
65.1 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MOGAT3 GST (N-Term) Protein

  • acyl coenzyme A:monoacylglycerol acyltransferase 3
  • Acyl-CoA:monoacylglycerol acyltransferase 3
  • DC72-acylglycerol O-acyltransferase 3
  • DGAT2L7MGC119203
  • Diacylglycerol acyltransferase 2-like protein 7
  • Diacylglycerol O-acyltransferase candidate 7
  • EC 2.3.1.20
  • EC 2.3.1.22
  • MGAT3
  • MGC119204
  • monoacylglycerol O-acyltransferase 3hDC7

Background

Acyl-CoA:monoacylglycerol acyltransferase (MOGAT; EC 2.3.1.22) catalyzes the synthesis of diacylglycerol from 2-monoacylglycerol and fatty acyl-CoA (Cheng et al., 2003 [PubMed 12618427]).[supplied by OMIM]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

8334-GT
Species: Hu
Applications: EnzAct
NBP1-88641
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
NB100-1872
Species: Hu, Mu, Rt
Applications: Flow, WB
NBP1-52078
Species: Hu
Applications: IHC, IHC-P, PEP-ELISA, WB
NBP1-59769
Species: Hu
Applications: WB
NBP1-69335
Species: Hu
Applications: IHC, IHC-P, WB
AF6868
Species: Hu
Applications: IHC, KO, WB
NB110-41487
Species: Hu, Mu, Rt
Applications: IB, ICC/IF, WB
538-MG
Species: Rt
Applications: BA
NBP1-91920
Species: Hu
Applications: IHC, IHC-P, WB
NBP3-13166
Species: Mu, Rt
Applications: ICC/IF, IHC, IHC-Fr, IHC-P, WB
NBP2-03433
Species: Ca, Hu, Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-P, WB
NBP2-13075
Species: Ba, Hu, Pm, Mu, Rt
Applications: DB, ELISA, IB, ICC/IF, IHC-FrFl, IHC, IHC-Fr, IHC-P, IP, WB
NBP3-05769
Species: Hu, Mu
Applications: Flow-IC, Flow, ICC/IF, IHC, IHC-P, WB
MAB5469
Species: Hu
Applications: ICC, WB
AF748
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB

Publications for MOGAT3 Recombinant Protein (H00346606-P01) (0)

There are no publications for MOGAT3 Recombinant Protein (H00346606-P01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOGAT3 Recombinant Protein (H00346606-P01) (0)

There are no reviews for MOGAT3 Recombinant Protein (H00346606-P01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOGAT3 Recombinant Protein (H00346606-P01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MOGAT3 Products

Bioinformatics Tool for MOGAT3 Recombinant Protein (H00346606-P01)

Discover related pathways, diseases and genes to MOGAT3 Recombinant Protein (H00346606-P01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOGAT3 Recombinant Protein (H00346606-P01)

Discover more about diseases related to MOGAT3 Recombinant Protein (H00346606-P01).

Blogs on MOGAT3

There are no specific blogs for MOGAT3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MOGAT3 GST (N-Term) Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MOGAT3