MOCS2 Antibody (4H3)

Images

 
There are currently no images for MOCS2 Antibody (H00004338-M05).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA
Clone
4H3
Clonality
Monoclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MOCS2 Antibody (4H3) Summary

Immunogen
MOCS2 (NP_789776.1, 1 a.a. - 88 a.a.) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG
Isotype
IgG1 Kappa
Clonality
Monoclonal
Host
Mouse
Gene
MOCS2
Purity
IgG purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
  • ELISA
Application Notes
It has been used for ELISA and WB.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
IgG purified

Notes

Quality control test: Antibody Reactive Against Recombinant Protein.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MOCS2 Antibody (4H3)

  • EC 2.-
  • MCBPE
  • MOCO1-A
  • MOCO1-B
  • MOCO1MOCS2B
  • MOCS2A
  • molybdenum cofactor biosynthesis protein E
  • molybdenum cofactor synthesis 2
  • Molybdenum cofactor synthesis protein 2 large subunit
  • Molybdenum cofactor synthesis protein 2 small subunit
  • Molybdenum cofactor synthesis protein 2A
  • Molybdenum cofactor synthesis protein 2B
  • molybdopterin synthase catalytic subunit
  • molybdopterin synthase sulfur carrier subunit
  • Molybdopterin-synthase large subunit
  • Molybdopterin-synthase small subunit
  • MPT synthase large subunit
  • MPTS
  • Sulfur carrier protein MOCS2A

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92130
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-03449
Species: Hu, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-17320
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-32423
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
AF5928
Species: Hu
Applications: WB, IHC, ICC
NB600-935
Species: Bv
Applications: WB, ELISA, IP
NBP1-87148
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-15304
Species: Hu, Mu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89783
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32907
Species: Hu, Mu, Rt
Applications: WB, Simple Western, ICC/IF, IHC, IHC-P, IP
NBP1-86665
Species: Hu
Applications: WB, IHC, IHC-P
UL-950
Species: Hu
MAB1106
Species: Hu
Applications: WB, ELISA(Cap), ELISA(Det), ELISA(Sta)
NBP1-77242
Species: Hu, Mu, Rt
Applications: WB, ELISA, IHC, IHC-P, IF
NBP2-34252
Species: Hu
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP
NBP1-31470
Species: Hu, Mu, Rt
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
NBP1-80841
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-90095
Species: Hu
Applications: IHC, IHC-P
AF527
Species: Mu
Applications: WB, IHC, Block, ICC
NBP2-57622
Species: Hu
Applications: WB, ICC/IF, IHC-P

Publications for MOCS2 Antibody (H00004338-M05) (0)

There are no publications for MOCS2 Antibody (H00004338-M05).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MOCS2 Antibody (H00004338-M05) (0)

There are no reviews for MOCS2 Antibody (H00004338-M05). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MOCS2 Antibody (H00004338-M05) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MOCS2 Products

Bioinformatics Tool for MOCS2 Antibody (H00004338-M05)

Discover related pathways, diseases and genes to MOCS2 Antibody (H00004338-M05). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MOCS2 Antibody (H00004338-M05)

Discover more about diseases related to MOCS2 Antibody (H00004338-M05).
 

Pathways for MOCS2 Antibody (H00004338-M05)

View related products by pathway.

Blogs on MOCS2

There are no specific blogs for MOCS2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MOCS2 Antibody (4H3) and receive a gift card or discount.

Bioinformatics

Gene Symbol MOCS2
Uniprot