MOCS2 Antibody (4H3) - Azide and BSA Free

Western Blot: MOCS2 Antibody (4H3) [H00004338-M05] - Detection against Immunogen (36.2 KDa) .

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 4H3
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MOCS2 Antibody (4H3) - Azide and BSA Free Summary

• Description: Quality control test: Antibody Reactive Against Recombinant Protein.
• Immunogen: MOCS2 (NP_789776.1, 1 a.a. ~ 88 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MVPLCQVEVLYFAKSAEITGVRSETISVPQEIKALQLWKEIETRHPGLADVRNQIIFAVRQEYVELGDQLLVLQPGDEIAVIPPISGG
• Isotype: IgG1 Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MOCS2
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Western Blot
• Application Notes: It has been used for ELISA and WB.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MOCS2 Antibody (4H3) - Azide and BSA Free

• EC 2.-
• MCBPE
• MOCO1-A
• MOCO1-B
• MOCO1MOCS2B
• MOCS2A
• molybdenum cofactor biosynthesis protein E
• molybdenum cofactor synthesis 2
• Molybdenum cofactor synthesis protein 2 large subunit
• Molybdenum cofactor synthesis protein 2 small subunit
• Molybdenum cofactor synthesis protein 2A
• Molybdenum cofactor synthesis protein 2B
• molybdopterin synthase catalytic subunit
• molybdopterin synthase sulfur carrier subunit
• Molybdopterin-synthase large subunit
• Molybdopterin-synthase small subunit
• MPT synthase large subunit
• MPTS
• Sulfur carrier protein MOCS2A

Background

Eukaryotic molybdoenzymes use a unique molybdenum cofactor (MoCo) consisting of a pterin, termed molybdopterin, and the catalytically active metal molybdenum. MoCo is synthesized from precursor Z by the heterodimeric enzyme molybdopterin synthase. The large and small subunits of molybdopterin synthase are both encoded from this gene by overlapping open reading frames. The proteins were initially thought to be encoded from a bicistronic transcript. They are now thought to be encoded from monocistronic transcripts. Alternatively spliced transcripts have been found for this locus that encode the large and small subunits. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MOCS2
• Uniprot:
  • NP_789776.1(Human)