MMP27 Antibody - BSA Free

Western Blot: MMP27 Antibody [NBP2-83215] - Host: Rabbit. Target Name: MMP27. Sample Tissue: Human DLD1 Whole Cell. Antibody Dilution: 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MMP27 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MMP27 Antibody - BSA Free (NBP2-83215) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MMP27. Peptide sequence: TRVHGRCPRYFDGPLGVLGHAFPPGPGLGGDTHFDEDENWTKDGAGFNLF The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMP27
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MMP27 Antibody - BSA Free

• EC 3.4.24
• EC 3.4.24.-
• EC 3.4.24.35
• matrix metallopeptidase 27
• matrix metalloprotease 27
• matrix metalloproteinase 27
• matrix metalloproteinase-27
• MMP27
• MMP-27
• UNQ2503/PRO5992

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normalphysiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in diseaseprocesses, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activatedwhen cleaved by extracellular proteinases. (provided by RefSeq)

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP27