MMP20 Antibody

Images

 
Western Blot: MMP20 Antibody [NBP1-62322] - HepG2 tissue lysate at a concentration of 1ug/ml.
Western Blot: MMP20 Antibody [NBP1-62322] - Human Fetal Muscle, Antibody Dilution: 1.0 ug/ml.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMP20 Antibody Summary

Immunogen
Synthetic peptides corresponding to MMP20(matrix metallopeptidase 20) The peptide sequence was selected from the middle region of MMP20. Peptide sequence AAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDA. The peptide sequence for this immunogen was taken from within the described region.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP20
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml
Application Notes
This is a rabbit polyclonal antibody against MMP20 and was validated on Western blot.
Theoretical MW
43 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MMP20 Antibody

  • AI2A2
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.22
  • EC 3.4.24.35
  • Enamel metalloproteinase
  • Enamelysin
  • matrix metallopeptidase 20
  • matrix metalloproteinase 20 (enamelysin)
  • matrix metalloproteinase-20
  • MMP20
  • MMP-20

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. MMP20 degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in the gene encoding MMP20, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta.Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. The protein encoded by this gene degrades amelogenin, the major protein component of dental enamel matrix, and so the protein is thought to play a role in tooth enamel formation. A mutation in this gene, which alters the normal splice pattern and results in premature termination of the encoded protein, has been associated with amelogenesis imperfecta. This gene is part of a cluster of MMP genes that localizes to chromosome 11q22.3. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1142
Species: Hu
Applications: CyTOF-ready, Flow, WB
1719-SE
Species: Hu
Applications: EnzAct
H00010117-Q01
Species: Hu
Applications: ELISA, AP, PA, WB
AF3026
Species: Mu
Applications: WB
NBP2-15373
Species: Hu, Mu
Applications: WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-87446
Species: Hu, Rt
Applications: IHC, IHC-P, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
DMP300
Species: Hu
Applications: ELISA
DMP900
Species: Hu
Applications: ELISA
AF6790
Species: Hu
Applications: IHC, WB
H00000054-D01P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
DCDL40
Species: Hu
Applications: ELISA
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
DM1300
Species: Hu
Applications: ELISA
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00054959-M02
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for MMP20 Antibody (NBP1-62322) (0)

There are no publications for MMP20 Antibody (NBP1-62322).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP20 Antibody (NBP1-62322) (0)

There are no reviews for MMP20 Antibody (NBP1-62322). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP20 Antibody (NBP1-62322) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP20 Products

Array NBP1-62322

Bioinformatics Tool for MMP20 Antibody (NBP1-62322)

Discover related pathways, diseases and genes to MMP20 Antibody (NBP1-62322). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP20 Antibody (NBP1-62322)

Discover more about diseases related to MMP20 Antibody (NBP1-62322).
 

Pathways for MMP20 Antibody (NBP1-62322)

View related products by pathway.

PTMs for MMP20 Antibody (NBP1-62322)

Learn more about PTMs related to MMP20 Antibody (NBP1-62322).
 

Research Areas for MMP20 Antibody (NBP1-62322)

Find related products by research area.

Blogs on MMP20

There are no specific blogs for MMP20, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP20
Uniprot