Home » MMP20 » MMP20 Research Products » MMP20 Antibody

MMP20 Antibody

 Submit a Review

Images

 
(
Enlarge)
Western Blot: MMP20 Antibody [H00009313-B01P] - Analysis of MMP20 expression in transfected 293T cell line by MMP20 polyclonal antibody. Lane 1: MMP20 transfected lysate(53.13 KDa). Lane 2: Non-transfected lysate.
Western Blot: MMP20 Antibody [H00009313-B01P] - Analysis of MMP20 expression in transfected 293T cell line by MMP20 polyclonal antibody. Lane 1: MMP20 transfected lysate(53.13 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

100% Guarantee on every product

MMP20 Antibody Summary

Immunogen
MMP20 (NP_004762.2, 1 a.a. - 483 a.a.) full-length human protein. MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MMP20
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.
Learn about the Innovator's Reward

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMP20 Antibody

  • AI2A2
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.22
  • EC 3.4.24.35
  • Enamel metalloproteinase
  • Enamelysin
  • matrix metallopeptidase 20
  • matrix metalloproteinase 20 (enamelysin)
  • matrix metalloproteinase-20
  • MMP-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MMP-25/MT6-MMP
Antibody (141808) [Un ...
MAB1142
MMP-25/MT6-MMP Antibody (141808) [Unconjugated]
(2 Publications)
Species: Hu
Applications: CyTOF-ready, Flow, WB
Kallikrein
4/Prostase/EMSP1 Anti ...
MAB35661
Kallikrein 4/Prostase/EMSP1 was detected in immersion fixed paraffin-embedded sections of human prostate using Mouse Anti-Human Kallikrein 4/Prostase/EMSP1 Monoclonal Antibody (Catalog # MAB35661) at 15 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Mouse HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS002) and counter­stained with hematoxylin (blue). Specific staining was localized to nuclei of epithelial cells. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Species: Hu
Applications: IHC, IP, Neut, WB
Recombinant Human
Enamelin GST (N-Term) ...
H00010117-Q01
12.5% SDS-PAGE Stained with Coomassie Blue.
(1 Publication)
Species: Hu
Applications: ELISA, Func, AP, PA, WB
Ameloblastin
Antibody
AF3026
Ameloblastin Antibody
(1 Publication)
Species: Mu
Applications: WB
AMELX Antibody
NBP2-15373
Western Blot: AMELX Antibody [NBP2-15373] - Sample (30 ug of whole cell lysate) A: NIH-3T3 12% SDS PAGE, antibody diluted at 1:500.
Western Blot: AMELX Antibody [NBP2-15373] - Sample (30 ug of whole cell lysate) A: Jurkat 12% SDS PAGE, antibody diluted at 1:500.
Species: Hu, Mu
Applications: WB
DSPP Antibody
NBP2-92546
Immunocytochemistry/Immunofluorescence: DSPP Antibody [NBP2-92546] - Analysis of H9C2 cells using DSPP . Blue: DAPI for nuclear staining.
Immunocytochemistry/Immunofluorescence: DSPP Antibody [NBP2-92546] - Analysis of L929 cells using DSPP . Blue: DAPI for nuclear staining.
Western Blot: DSPP Antibody [NBP2-92546] - Analysis of extracts of various cell lines, using DSPP at 1:1000 dilution.Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 30s.
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
Tuftelin 1 Antibody
NBP1-87446
Western Blot: Tuftelin 1 Antibody [NBP1-87446] - Lane 1: NIH-3T3 cell lysate (Mouse embryonic fibroblast cells). Lane 2: NBT-II cell lysate (Rat Wistar bladder tumor cells).
Immunohistochemistry-Paraffin: Tuftelin 1 Antibody [NBP1-87446] - Staining of human placenta shows moderate cytoplasmic positivity in trophoblastic cells.
Immunohistochemistry-Paraffin: Tuftelin 1 Antibody [NBP1-87446] - Staining of human skin shows moderate cytoplasmic positivity in squamous epithelial cells.
(1 Publication)
Species: Hu, Rt
Applications: IHC, IHC-P, WB
MMP-2 [HRP]
MMP200
(3 Reviews)
(79 Publications)
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
MMP-3 [HRP]
DMP300
(1 Review)
(42 Publications)
Species: Hu
Applications: ELISA
MMP-9 [HRP]
DMP900
(7 Reviews)
(186 Publications)
Species: Hu
Applications: ELISA
MMP-19 Antibody
AF6790
MMP-19 was detected in immersion fixed paraffin-embedded sections of human melanoma using Goat Anti-Human MMP-19 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6790) at 10 µg/mL overnight at 4 °C. Before incubation with the primary antibody, tissue was subjected to heat-induced epitope retrieval using Antigen Retrieval Reagent-Basic (Catalog # CTS013). Tissue was stained using the Anti-Goat HRP-DAB Cell & Tissue Staining Kit (brown; Catalog # CTS008) and counterstained with hematoxylin (blue). Specific staining was localized to cytoplasm and plasma membranes. View our protocol for Chromogenic IHC Staining of Paraffin-embedded Tissue Sections.
Western blot shows lysates of HeLa human cervical epithelial carcinoma cell line and human small intestine tissue. PVDF membrane was probed with 1 µg/mL of Goat Anti-Human MMP-19 Antigen Affinity-purified Polyclonal Antibody (Catalog # AF6790) followed by HRP-conjugated Anti-Goat IgG Secondary Antibody (Catalog # HAF019). Specific bands were detected for MMP-19 at approximately 57 and 50 kDa (as indicated). This experiment was conducted under reducing conditions and using Immunoblot Buffer Group 1.
(2 Reviews)
Species: Hu
Applications: IHC, WB
TRACP/PAP/ACP5
Antibody
H00000054-D01P
Western Blot: ACP5 Antibody [H00000054-D01P] - Analysis of ACP5 expression in transfected 293T cell line by ACP5 polyclonal antibody.Lane 1: ACP5 transfected lysate(36.60 KDa).Lane 2: Non-transfected lysate.
Western Blot: ACP5 Antibody [H00000054-D01P] - Analysis of ACP5 expression in human liver.
(3 Publications)
Species: Hu, Mu
Applications: IHC, IHC-P, WB
TDRD7 Antibody
NBP1-87315
Immunohistochemistry: TDRD7 Antibody [NBP1-87315] - Staining of human testis shows cytoplasmic and nuclear positivity in subsets of testicular cells.
(1 Publication)
Species: Hu
Applications: IHC, IHC-P
CD40 Ligand/TNFSF5
[HRP]
DCDL40
(41 Publications)
Species: Hu
Applications: ELISA
SCYL1 Antibody
(2E5)
H00057410-M02
Sandwich ELISA: SCYL1 Antibody (2E5) [H00057410-M02] - Detection limit for recombinant GST tagged SCYL1 is 0.03 ng/ml as a capture antibody.
Western Blot: SCYL1 Antibody (2E5) [H00057410-M02] - SCYL1 monoclonal antibody (M02), clone 2E5. Analysis of SCYL1 expression in PC-12.
Western Blot: SCYL1 Antibody (2E5) [H00057410-M02] - SCYL1 monoclonal antibody (M02), clone 2E5. Analysis of SCYL1 expression in Hela S3 NE.
(1 Publication)
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
MMP-13 [HRP]
DM1300
(1 Review)
(31 Publications)
Species: Hu
Applications: ELISA
TRAF-2 Antibody
NB100-56173
Immunocytochemistry/Immunofluorescence: TRAF-2 Antibody [NB100-56173] - Immunostaining of HN30 and MCF-12a cells for TRAF2 3 days post-transfectionMCF-12a NT (DAPI): non-treated MCF-12a DAPI stained, MCF-12a NT (TRAF2-FITC): non-treated MCF-12a FITC stained for TRAF2, MCF-12a pNSP 5a3a (DAPI): MCF-12a transfected with pcDNA 3.0 NSP 5a3a DAPI stained, MCF-12a pNSP 5a3a (TRAF2-FITC): MCF-12a transfected with pcDNA 3.0 NSP 5a3a FITC stained for Traf-2, HN30 NT (DAPI): non-treated HN30 DAPI stained, HN30 NT (TRAF2-FITC): non-treated HN30 FITC stained for TRAF2, HN30 pNSP 5a3a (DAPI): HN30 transfected with pcDNA 3.0 NSP 5a3a DAPI stained, HN30 pNSP 5a3a (TRAF2-FITC): HN30 transfected with pcDNA 3.0 NSP 5a3a FITC stained for TRAF2. White arrows indicate apoptotic bodies. Image collected and cropped by Citeab from the following publication (A novel dual signaling axis for NSP 5a3a induced apoptosis in head and neck carcinoma. Oncotarget (2011) licensed under a CC-BY licence.
Immunohistochemistry: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human melanoma tissue section stained for TRAF2 at 1:2000. A1 is a higher magnification of A. Hematoxylin-eosin counterstain.
Immunohistochemistry-Paraffin: TRAF-2 Antibody [NB100-56173] - Formalin-fixed, paraffin-embedded human colon carcinoma tissue sections stained for TRAF2 using this antibody at 1:2000. Hematoxylin-eosin counterstain.
(3 Publications)
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
ODAM Antibody (2F8)
H00054959-M02
Western Blot: APIN Antibody (2F8) [H00054959-M02] - Analysis of ODAM expression in transfected 293T cell line by ODAM monoclonal antibody (M02), clone 2F8.Lane 1: ODAM transfected lysate (Predicted MW: 17.4 KDa).Lane 2: Non-transfected lysate.
ELISA: ODAM Antibody (2F8) [H00054959-M02] - APIN Antibody (2F8) [H00054959-M02] - Detection limit for recombinant GST tagged ODAM is 0.1 ng/ml as a capture antibody.
(1 Publication)
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for MMP20 Antibody (H00009313-B01P) (0)

There are no publications for MMP20 Antibody (H00009313-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP20 Antibody (H00009313-B01P) (0)

There are no reviews for MMP20 Antibody (H00009313-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP20 Antibody (H00009313-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP20 Products

Array H00009313-B01P

Bioinformatics Tool for MMP20 Antibody (H00009313-B01P)

Discover related pathways, diseases and genes to MMP20 Antibody (H00009313-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP20 Antibody (H00009313-B01P)

Discover more about diseases related to MMP20 Antibody (H00009313-B01P).
 

Pathways for MMP20 Antibody (H00009313-B01P)

View related products by pathway.

PTMs for MMP20 Antibody (H00009313-B01P)

Learn more about PTMs related to MMP20 Antibody (H00009313-B01P).

Blogs on MMP20

There are no specific blogs for MMP20, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

  PDF Datasheet
  Request CofA
  Request SDS

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP20 Antibody and receive a gift card or discount.


Bioinformatics

Gene Symbol MMP20
Uniprot