MMP20 Antibody

Images

 
Western Blot: MMP20 Antibody [H00009313-B01P] - Analysis of MMP20 expression in transfected 293T cell line by MMP20 polyclonal antibody. Lane 1: MMP20 transfected lysate(53.13 KDa). Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Mouse
Conjugate
Unconjugated

Order Details

MMP20 Antibody Summary

Immunogen
MMP20 (NP_004762.2, 1 a.a. - 483 a.a.) full-length human protein. MKVLPASGLAVFLIMALKFSTAAPSLVAASPRTWRNNYRLAQAYLDKYYTNKEGHQIGEMVARGSNSMIRKIKELQAFFGLQVTGKLDQTTMNVIKKPRCGVPDVANYRLFPGEPKWKKNTLTYRISKYTPSMSSVEVDKAVEMALQAWSSAVPLSFVRINSGEADIMISFENGDHGDSYPFDGPRGTLAHAFAPGEGLGGDTHFDNAEKWTMGTNGFNLFTVAAHEFGHALGLAHSTDPSALMYPTYKYKNPYGFHLPKDDVKGIQALYGPRKVFLGKPTLPHAPHHKPSIPDLCDSSSSFDAVTMLGKELLLFKDRIFWRRQVHLRTGIRPSTITSSFPQLMSNVDAAYEVAERGTAYFFKGPHYWITRGFQMQGPPRTIYDFGFPRHVQQIDAAVYLREPQKTLFFVGDEYYSYDERKRKMEKDYPKNTEEEFSGVNGQIDAAVELNGYIYFFSGPKTYKYDTEKEDVVSVVKSSSWIGC
Isotype
IgG
Clonality
Polyclonal
Host
Mouse
Gene
MMP20
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
This antibody is useful for Western Blot, Functional

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMP20 Antibody

  • AI2A2
  • EC 3.4.24
  • EC 3.4.24.-
  • EC 3.4.24.22
  • EC 3.4.24.35
  • Enamel metalloproteinase
  • Enamelysin
  • matrix metallopeptidase 20
  • matrix metalloproteinase 20 (enamelysin)
  • matrix metalloproteinase-20
  • MMP-20

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MAB1142
Species: Hu
Applications: CyTOF-ready, Flow, WB
MAB35661
Species: Hu
Applications: IHC, IP, Neut, WB
H00010117-Q01
Species: Hu
Applications: ELISA, Func, AP, PA, WB
AF3026
Species: Mu
Applications: WB
NBP2-15373
Species: Hu, Mu
Applications: WB
NBP2-92546
Species: Hu, Mu, Rt
Applications: ICC/IF, WB
NBP1-87446
Species: Hu, Rt
Applications: IHC, IHC-P, WB
MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
DMP300
Species: Hu
Applications: ELISA
DMP900
Species: Hu
Applications: ELISA
AF6790
Species: Hu
Applications: IHC, WB
H00000054-D01P
Species: Hu, Mu
Applications: IHC, IHC-P, WB
NBP1-87315
Species: Hu
Applications: IHC, IHC-P
DCDL40
Species: Hu
Applications: ELISA
H00057410-M02
Species: Hu, Mu, Rt
Applications: ELISA, S-ELISA, WB
DM1300
Species: Hu
Applications: ELISA
NB100-56173
Species: Hu
Applications: Flow, ICC/IF, IHC, IHC-P, IP, WB
H00054959-M02
Species: Hu
Applications: ELISA, ICC/IF, WB

Publications for MMP20 Antibody (H00009313-B01P) (0)

There are no publications for MMP20 Antibody (H00009313-B01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP20 Antibody (H00009313-B01P) (0)

There are no reviews for MMP20 Antibody (H00009313-B01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP20 Antibody (H00009313-B01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP20 Products

Array H00009313-B01P

Bioinformatics Tool for MMP20 Antibody (H00009313-B01P)

Discover related pathways, diseases and genes to MMP20 Antibody (H00009313-B01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP20 Antibody (H00009313-B01P)

Discover more about diseases related to MMP20 Antibody (H00009313-B01P).
 

Pathways for MMP20 Antibody (H00009313-B01P)

View related products by pathway.

PTMs for MMP20 Antibody (H00009313-B01P)

Learn more about PTMs related to MMP20 Antibody (H00009313-B01P).

Blogs on MMP20

There are no specific blogs for MMP20, but you can read our latest blog posts.
Omicron Variant Antibodies

Customers Who Bought This Also Bought

Contact Information

Download our Western Blot eHandbook

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP20 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP20
Uniprot