MMP-7 Antibody


Immunocytochemistry/ Immunofluorescence: MMP-7 Antibody [NBP2-57142] - Staining of human cell line A549 shows localization to nucleoplasm, cytosol & vesicles.

Product Details

Reactivity HuSpecies Glossary
Applications ICC/IF

Order Details

MMP-7 Antibody Summary

This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHG
Specificity of human MMP-7 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.


  • Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Application Notes
Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
MMP-7 Recombinant Protein Antigen (NBP2-57142PEP)

Packaging, Storage & Formulations

Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
PBS (pH 7.2) and 40% Glycerol
0.02% Sodium Azide
Affinity purified

Alternate Names for MMP-7 Antibody

  • EC 3.4.24
  • EC
  • Matrilysin
  • matrin
  • matrix metallopeptidase 7 (matrilysin, uterine)
  • matrix metalloproteinase 7 (matrilysin, uterine)
  • Matrix metalloproteinase-7
  • MMP7
  • MMP-7
  • MPSL1
  • Pump-1 protease
  • PUMP1
  • PUMP-1
  • uterine matrilysin
  • Uterine metalloproteinase


This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

Species: Hu, Mu, Rt, Po, Ca
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
Species: Hu, Mu, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P
Species: Hu
Applications: WB, IHC, IP, ICC
Species: Hu, Mu, Rt, Ch, Pm
Applications: WB, Simple Western, Flow, ICC/IF, IHC, IHC-P, IP, Flow-IC
Species: Mu
Applications: WB, Simple Western, IHC

Publications for MMP-7 Antibody (NBP2-57142) (0)

There are no publications for MMP-7 Antibody (NBP2-57142).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-7 Antibody (NBP2-57142) (0)

There are no reviews for MMP-7 Antibody (NBP2-57142). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MMP-7 Antibody (NBP2-57142) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies


Isotype Controls

Other Available Formats

Additional MMP-7 Products

Bioinformatics Tool for MMP-7 Antibody (NBP2-57142)

Discover related pathways, diseases and genes to MMP-7 Antibody (NBP2-57142). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-7 Antibody (NBP2-57142)

Discover more about diseases related to MMP-7 Antibody (NBP2-57142).

Pathways for MMP-7 Antibody (NBP2-57142)

View related products by pathway.

PTMs for MMP-7 Antibody (NBP2-57142)

Learn more about PTMs related to MMP-7 Antibody (NBP2-57142).

Research Areas for MMP-7 Antibody (NBP2-57142)

Find related products by research area.

Blogs on MMP-7.

Toll-like receptors in the intestinal epithelial cells
By Jamshed Arslan, Pharm. D., PhD. Toll-like receptors (TLRs) are microbe-sensing proteins that act as first responders to danger signals. TLRs help the intestinal epithelial cells (IECs) recognize commensal bacteria...  Read full blog post.

Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Learn the difference between western blot and simple western

Product PDFs


Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.


Review this Product

Be the first to review our MMP-7 Antibody and receive a gift card or discount.


Gene Symbol MMP7