MMP-7 Antibody

Immunocytochemistry/Immunofluorescence: MMP-7 Antibody [NBP2-57142] - Staining of human cell line A549 shows localization to nucleoplasm, cytosol & vesicles.

Product Discontinued

MMP-7 Antibody Summary

• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence: PDVAEYSLFPNSPKWTSKVVTYRIVSYTRDLPHITVDRLVSKALNMWGKEIPLHFRKVVWGTADIMIGFARGAHG
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MMP7
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
• Application Notes: Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MMP-7 Antibody

• EC 3.4.24
• EC 3.4.24.23
• Matrilysin
• matrin
• matrix metallopeptidase 7 (matrilysin, uterine)
• matrix metalloproteinase 7 (matrilysin, uterine)
• Matrix metalloproteinase-7
• MMP7
• MMP-7
• MPSL1
• Pump-1 protease
• PUMP1
• PUMP-1
• uterine matrilysin
• Uterine metalloproteinase

Background

MMP7 is a Metallopeptidase M10A type protease. MMP-7 (Matrilysin) is constitutively produced by exocrine epithelial cells through out the body. It is capable of degrading casein, fibronectin, gelatins of types 1, III, IV, and V, in addition to activating procollagenase. It has been shown to play a key role in invasion by carcinomas.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MMP7