Recombinant Human MMP-19 Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Recombinant Human MMP-19 Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 508 of Human MMP19 full-length ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MNCQQLWLGFLLPMTVSGRVLGLAEVAPVDYLSQYGYLQKPLEGSNNFKPEDITEALRAFQEASELPVSGQLDDATRARMRQPRCGLEDPFNQKTLKYLLLGRWRKKHLTFRILNLPSTLPPHTARAALRQAFQDWSNVAPLTFQEVQAGAADIRLSFHGRQSSYCSNTFDGPGRVLAHADIPELGSVHFDEDEFWTEGTYRGVNLRIIAAHEVGHALGLGHSRYSQALMAPVYEGYRPHFKLHPDDVAGIQALYGKKSPVIRDEEEEETELPTVPPVPTEPSPMPDPCSSELDAMMLGPRGKTYAFKGDYVWTVSDSGPGPLFRVSALWEGLPGNLDAAVYSPRTQWIHFFKGDKVWRYINFKMSPGFPKKLNRVEPNLDAALYWPLNQKVFLFKGSGYWQWDELARTDFSSYPKPIKGLFTGVPNQPSAAMSWQDGRVYFFKGKVYWRLNQQLRVEKGYPRNISHNWMHCRPRTIDTTPSGGNTTPSGTGITLDTTLSATETTFEY

Protein/Peptide Type
Recombinant Protein
Gene
MMP19

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
50 mM Tris-HCl, 10 mM reduced Glutathione, pH 8.0 in the elution buffer.

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Recombinant Human MMP-19 Protein

  • EC 3.4.24.-
  • matrix metallopeptidase 19
  • matrix metalloproteinase 18
  • matrix metalloproteinase 19
  • Matrix metalloproteinase RASI
  • Matrix metalloproteinase-18
  • matrix metalloproteinase-19
  • MMP-18
  • MMP18MMP-19
  • MMP19
  • MMP-19
  • RASI
  • RASI-1

Background

Proteins of the matrix metalloproteinase (MMP) family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. Most MMP's are secreted as inactive proproteins which are activated when cleaved by extracellular proteinases. This protein is expressed in human epidermis and it has a role in cellular proliferation as well as migration and adhesion to type I collagen. Multiple transcript variants encoding distict isoforms have been identified for this gene. [provided by RefSeq]

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-17314
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
MAB9181
Species: Hu
Applications: WB, Flow, IHC, IP, CyTOF-ready
H00056547-M01
Species: Hu
Applications: WB, ELISA
MAB1142
Species: Hu
Applications: WB, Flow, CyTOF-ready
MAB3657
Species: Hu
Applications: CyTOF-ready, ICFlow
AB924
Species: Hu, Mu
Applications: WB, IHC, IP
AF1785
Species: Hu
Applications: WB, IHC, IP
MAB9161
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow

Publications for MMP-19 Recombinant Protein (H00004327-P02) (0)

There are no publications for MMP-19 Recombinant Protein (H00004327-P02).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-19 Recombinant Protein (H00004327-P02) (0)

There are no reviews for MMP-19 Recombinant Protein (H00004327-P02). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP-19 Recombinant Protein (H00004327-P02) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MMP-19 Products

Bioinformatics Tool for MMP-19 Recombinant Protein (H00004327-P02)

Discover related pathways, diseases and genes to MMP-19 Recombinant Protein (H00004327-P02). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-19 Recombinant Protein (H00004327-P02)

Discover more about diseases related to MMP-19 Recombinant Protein (H00004327-P02).
 

Pathways for MMP-19 Recombinant Protein (H00004327-P02)

View related products by pathway.

PTMs for MMP-19 Recombinant Protein (H00004327-P02)

Learn more about PTMs related to MMP-19 Recombinant Protein (H00004327-P02).
 

Research Areas for MMP-19 Recombinant Protein (H00004327-P02)

Find related products by research area.

Blogs on MMP-19

There are no specific blogs for MMP-19, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Recombinant Human MMP-19 Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP19
Entrez