MMP-14/MT1-MMP Recombinant Protein Antigen

Images

 
There are currently no images for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

MMP-14/MT1-MMP Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP14.

Source: E. coli

Amino Acid Sequence: HWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEG

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
MMP14
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38649.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
26 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for MMP-14/MT1-MMP Recombinant Protein Antigen

  • EC 3.4.24
  • EC 3.4.24.80
  • matrix metallopeptidase 14 (membrane-inserted)
  • matrix metalloproteinase 14 (membrane-inserted)
  • matrix metalloproteinase-14
  • membrane type 1 metalloprotease
  • Membrane-type matrix metalloproteinase 1
  • Membrane-type-1 matrix metalloproteinase
  • MMP14
  • MMP-14
  • MMP-X1
  • MT1MMP
  • MT1-MMP
  • MT1-MMPMTMMP1
  • MT-MMP 1
  • MT-MMP1

Background

The matrix metalloproteinase (MMP) family (approximately 25 members in mammals) has been implicated in extracellular matrix remodeling associated with embryonic development, cancer formation and progression, and various other physiological and pathological events. MMP-14 is a membrane-bound matrix metalloproteinase (MT-MMP) capable of mediating pericellular proteolysis of extracellular matrix components. MMP-14 is therefore thought to be an important molecular tool for cellular remodeling of the surrounding matrix (1). Gelatinase A (type-IV collagenase; M(r) 72,000) is produced by tumour stroma cells and is believed to be crucial for their invasion and metastasis, acting by degrading extracellular matrix macro-molecules such as type IV collagen. MMP-14 may thus trigger invasion by tumor cells by activating pro-gelatinase A on the tumor cell surface (2). Observations identify MT1-MMP as a tumor-derived growth factor that regulates proliferation by controlling cell geometry within the confines of the 3D extracellular matrix (ECM) (3).

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

MMP200
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
DTM200
Species: Hu
Applications: ELISA
DMP900
Species: Hu
Applications: ELISA
DTM100
Species: Hu
Applications: ELISA
DM1300
Species: Hu
Applications: ELISA
MAB901
Species: Hu
Applications: IHC, IP, KO, Neut, WB
DMP300
Species: Hu
Applications: ELISA
MAB9161
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
AF1785
Species: Hu
Applications: IHC, IP, WB
DVE00
Species: Hu
Applications: ELISA
AF972
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
DMP700
Species: Hu
Applications: ELISA
NBP2-10437
Species: Hu
Applications: WB
NBP1-28912
Species: Rt
Applications: PEP-ELISA, WB
H00004499-P01
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB

Publications for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP) (0)

There are no publications for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP) (0)

There are no reviews for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional MMP-14/MT1-MMP Products

Research Areas for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP)

Find related products by research area.

Blogs on MMP-14/MT1-MMP

There are no specific blogs for MMP-14/MT1-MMP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our MMP-14/MT1-MMP Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP14