MMP-14/MT1-MMP Recombinant Protein Antigen Summary
| Description |
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human MMP14. Source: E. coli
Amino Acid Sequence: HWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEG Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)
This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions. |
| Source |
E. coli |
| Protein/Peptide Type |
Recombinant Protein Antigen |
| Gene |
MMP14 |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Applications/Dilutions
| Dilutions |
- Antibody Competition 10 - 100 molar excess
|
| Application Notes |
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-38649. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml. For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com |
| Theoretical MW |
26 kDa. Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors. |
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS and 1M Urea, pH 7.4. |
| Preservative |
No Preservative |
| Purity |
>80% by SDS-PAGE and Coomassie blue staining |
Alternate Names for MMP-14/MT1-MMP Recombinant Protein Antigen
Background
The matrix metalloproteinase (MMP) family (approximately 25 members in mammals) has been implicated in extracellular matrix remodeling associated with embryonic development, cancer formation and progression, and various other physiological and pathological events. MMP-14 is a membrane-bound matrix metalloproteinase (MT-MMP) capable of mediating pericellular proteolysis of extracellular matrix components. MMP-14 is therefore thought to be an important molecular tool for cellular remodeling of the surrounding matrix (1). Gelatinase A (type-IV collagenase; M(r) 72,000) is produced by tumour stroma cells and is believed to be crucial for their invasion and metastasis, acting by degrading extracellular matrix macro-molecules such as type IV collagen. MMP-14 may thus trigger invasion by tumor cells by activating pro-gelatinase A on the tumor cell surface (2). Observations identify MT1-MMP as a tumor-derived growth factor that regulates proliferation by controlling cell geometry within the confines of the 3D extracellular matrix (ECM) (3).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are
guaranteed for 3 months from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Ca, Hu, Mu, Po, Rt
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA
Species: Hu
Applications: IHC, IP, KO, Neut, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: CyTOF-ready, IHC, ICFlow, WB
Species: Hu
Applications: IHC, IP, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: ELISA, IHC, KO, Simple Western, WB
Species: Hu
Applications: ELISA
Species: Hu
Applications: BA
Species: Hu
Applications: WB
Species: Rt
Applications: PEP-ELISA, WB
Species: Hu
Applications: ELISA, AP, PA, PAGE, WB
Publications for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP) (0)
There are no publications for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP) (0)
There are no reviews for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
FAQs for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP) (0)
Additional MMP-14/MT1-MMP Products
Research Areas for MMP-14/MT1-MMP Recombinant Protein Antigen (NBP2-38649PEP)
Find related products by research area.
|
Blogs on MMP-14/MT1-MMP