MMP-14/MT1-MMP Antibody

Images

 
Western Blot: MMP-14/MT1-MMP Antibody [H00004323-D01P] - Analysis of MMP14 expression in transfected 293T cell line by MMP14 polyclonal antibody.Lane 1: MMP14 transfected lysate(65.90 KDa).Lane 2: Non-transfected lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MMP-14/MT1-MMP Antibody Summary

Immunogen
MMP14 (AAH64803.1, 1 a.a. - 582 a.a.) full-length human protein. MSPAPRPSRCLLLPLLTLGTALASLGSAQSSSFSPEAWLQQYGYLPPGDLRTHTQRSPQSLSAAIAAMQKFYGLQVTGKADADTMKAMRRPRCGVPDKFGAEIKANVRRKRYAIQGLKWQHNEITFCIQNYTPKVGEYATYEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMIFFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVRNEDLNGNDIFLVAVHELGHALGLEHSSDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGGESGFPTKMPPQPRTTSRPSVPDKPKNPTYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEELRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGGGAVSAAAVVLPVLLLLLVLAVGLAVFFFRRHGTPRRLLYCQRSLLDKV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MMP14
Purity
Protein G purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot
Application Notes
It has been used for WB and as a detection antibody in ELISA.

Packaging, Storage & Formulations

Storage
Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.4)
Preservative
No Preservative
Purity
Protein G purified

Notes

Quality control test: Antibody reactive against mammalian transfected lysate.

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MMP-14/MT1-MMP Antibody

  • EC 3.4.24
  • EC 3.4.24.80
  • matrix metallopeptidase 14 (membrane-inserted)
  • matrix metalloproteinase 14 (membrane-inserted)
  • matrix metalloproteinase-14
  • membrane type 1 metalloprotease
  • Membrane-type matrix metalloproteinase 1
  • Membrane-type-1 matrix metalloproteinase
  • MMP14
  • MMP-14
  • MMP-X1
  • MT1MMP
  • MT1-MMP
  • MT1-MMPMTMMP1
  • MT-MMP 1
  • MT-MMP1

Background

The matrix metalloproteinases (MMPs) are a family of at least eighteen secreted and membrane bound zincendopeptidases. Collectively, these enzymes can degrade all the components of the extracellular matrix, including fibrillar and non fibrillar collagens, fibronectin, laminin and basement membrane glycoproteins. In general, a signal peptide, a propeptide, and a catalytic domain containing the highly conserved zinc binding site characterizes the structure of the MMPs. In addition, fibronectin like repeats, a hinge region, and a C terminal hemopexin like domain allow categorization of MMPs into the collagenase, gelatinase, stomelysin and membrane-type MMP subfamilies. All MMPs are synthesized as proenzymes, and most of them are secreted from the cells as proenzymes. Thus, the activation of these proenzymes is a critical step that leads to extracellular matrix breakdown. MMPs are considered to play an important role in wound healing, apoptosis, bone elongation, embryo development, uterine involution, angiogenesis and tissue remodeling, and in diseases such as multiple sclerosis, Alzheimer's, malignant gliomas, lupus, arthritis, periodontis, glumerulonephritis, atherosclerosis, tissue ulceration, and in cancer cell invasion and metastasis. MMP14 may be an activator of pro gelatinase A and is expressed in fibroblast cells during both wound healing and human cancer progression. MMP14 is expressed in very low levels and may require stimulation with concanavolin A or the phorbol ester TPA to stimulate production of MMP14.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NB200-193
Species: Hu, Mu, Rt, Ch, GP
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P
MAB9161
Species: Hu
Applications: WB, IHC, CyTOF-ready, ICFlow
AF1785
Species: Hu
Applications: WB, IHC, IP
AF972
Species: Hu
Applications: WB, Simple Western, IHC
NBP1-28912
Species: Hu
Applications: WB, PEP-ELISA
H00004498-R01
Species: Hu
H00004323-D01P
Species: Hu
Applications: WB

Publications for MMP-14/MT1-MMP Antibody (H00004323-D01P) (0)

There are no publications for MMP-14/MT1-MMP Antibody (H00004323-D01P).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MMP-14/MT1-MMP Antibody (H00004323-D01P) (0)

There are no reviews for MMP-14/MT1-MMP Antibody (H00004323-D01P). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MMP-14/MT1-MMP Antibody (H00004323-D01P) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MMP-14/MT1-MMP Products

Bioinformatics Tool for MMP-14/MT1-MMP Antibody (H00004323-D01P)

Discover related pathways, diseases and genes to MMP-14/MT1-MMP Antibody (H00004323-D01P). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MMP-14/MT1-MMP Antibody (H00004323-D01P)

Discover more about diseases related to MMP-14/MT1-MMP Antibody (H00004323-D01P).
 

Pathways for MMP-14/MT1-MMP Antibody (H00004323-D01P)

View related products by pathway.

PTMs for MMP-14/MT1-MMP Antibody (H00004323-D01P)

Learn more about PTMs related to MMP-14/MT1-MMP Antibody (H00004323-D01P).
 

Research Areas for MMP-14/MT1-MMP Antibody (H00004323-D01P)

Find related products by research area.

Blogs on MMP-14/MT1-MMP

There are no specific blogs for MMP-14/MT1-MMP, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MMP-14/MT1-MMP Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MMP14
Entrez
Uniprot