MLLT11 Antibody (2A9-1B7) - Azide and BSA Free

ELISA: MLLT11 Antibody (2A9-1B7) [H00010962-M01] - Detection limit for recombinant GST tagged MLLT11 is approximately 1ng/ml as a capture antibody.

ELISA: MLLT11 Antibody (2A9-1B7) [H00010962-M01] - Detection limit for recombinant GST tagged MLLT11 is approximately 0.03ng/ml as a capture antibody.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, ICC/IF, IHC
• Clone: 2A9-1B7
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MLLT11 Antibody (2A9-1B7) - Azide and BSA Free Summary

• Immunogen: AF1Q (AAH09624, 1 a.a. ~ 90 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. MRDPVSSQYSSFLFWRMPIPELDLSELEGLGLSDTATYKVKDSSVGKMIGQATAADQEKNPEGDGLLEYSTFNFWRAPIASIHSFELDLL
• Specificity: MLLT11 - ALL1-fused gene from chromosome 1q
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MLLT11
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry
  • Western Blot 1:500
• Application Notes: Antibody reactive against recombinant protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.

Reactivity Notes

Other species not tested.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MLLT11 Antibody (2A9-1B7) - Azide and BSA Free

• AF1QRP11-316M1.10
• ALL1 fused gene from chromosome 1q
• ALL1-fused gene from chromosome 1q
• myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 11
• protein AF1q

Background

The gene variously symbolized ALL1, HRX, or MLL located on 11q23 has been demonstrated to be fused with a number of translocation partners in cases of leukemia. t(1;11)(q21;q23) translocations that fused the MLL gene to a gene on chromosomal band 1q21 in 2 infants with acute myelomonocytic leukemia have been demonstrated. The N-terminal portion of the MLL gene is critical for leukemogenesis in translocations involving band 11q23. This gene encodes 90 amino acids. It was found to be highly expressed in the thymus but not in peripheral lymphoid tissues. In contrast to its restricted distribution in normal hematopoietic tissue, this gene was expressed in all leukemic cell lines tested.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for MLLT11 Antibody (H00010962-M01)(5)

Publications using H00010962-M01

• Yamada M, Clark J, Iulianella A. MLLT11/AF1q is differentially expressed in maturing neurons during development. Gene Expr Patterns. 2014-05-16 [PMID: 24839873]
• Tiberio P, Cavadini E, Callari M et al. AF1q: a novel mediator of basal and 4-HPR-induced apoptosis in ovarian cancer cells. PLoS One. 2012-01-01 [PMID: 22761939] (WB, Human)
• Parcelier A, Maharzi N, Delord M et al. AF1q/MLLT11 regulates the emergence of human prothymocytes through cooperative interaction with the Notch signaling pathway. Blood. 2011-06-28 [PMID: 21715312]
• Co NN, Tsang WP, Wong TW et al. Oncogene AF1q enhances doxorubicin-induced apoptosis through BAD-mediated mitochondrial apoptotic pathway. Mol Cancer Ther;7(10):3160-8. 2008-10-01 [PMID: 18852119]
• Chang XZ, Li DQ, Hou YF et al. Identification of the functional role of AF1Q in the progression of breast cancer. Breast Cancer Res Treat;111(1):65-78. 2008-09-01 [PMID: 17929166]

Bioinformatics

• Gene Symbol: MLLT11
• Entrez:
  • 10962(Human)
• OMIM:
  • 604684(Human)
• Uniprot:
  • AAH09624(Human)