MKRN3 Antibody

Images

 
Western Blot: MKRN3 Antibody [NBP2-85295] - Host: Rabbit. Target Name: Mkrn3. Sample Type: Rat Spleen lysates. Antibody Dilution: 1.0ug/ml

Product Details

Summary
Reactivity Rt, Hu, Mu, Po, RbSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MKRN3 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of Rat MKRN3. Peptide sequence: ARGGQDSQPRASADRGPKMATHWEPPTQEVAEAPPTASSSSLPLIGSAAE The peptide sequence for this immunogen was taken from within the described region.
Predicted Species
Human (100%), Mouse (100%), Porcine (92%), Rabbit (93%). Backed by our 100% Guarantee.
Clonality
Polyclonal
Host
Rabbit
Gene
MKRN3
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MKRN3 Antibody

  • EC 6.3.2.-
  • makorin ring finger protein 3
  • MGC88288
  • RNF63D15S9
  • ZFP127RING finger protein 63
  • Zinc finger protein 127
  • ZNF127probable E3 ubiquitin-protein ligase makorin-3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-20439
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00004692-M02
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, RNAi
NBP1-89917
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
H00007337-M01
Species: Hu, Rt
Applications: WB, ELISA, ICC/IF, IHC, IHC-P, KD
NB300-199
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IHC-P, IHC-FrFl
NBP1-71770
Species: Hu, Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87299
Species: Hu
Applications: WB, ICC/IF
PP-H4417-00
Species: Hu
Applications: WB, IP, DirELISA
NBP2-26190
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-46379
Species: Hu
Applications: WB, IHC
NB300-514
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
H00006047-A01
Species: Hu
Applications: WB, ELISA, IP
NBP2-49382
Species: Hu
Applications: IHC, IHC-P
H00008926-B01P
Species: Hu
Applications: WB, ICC/IF
H00002011-M01
Species: Hu, Mu, Rt
Applications: WB, ELISA, ICC/IF
NBP2-85295
Species: Rt, Hu, Mu, Po, Rb
Applications: WB

Publications for MKRN3 Antibody (NBP2-85295) (0)

There are no publications for MKRN3 Antibody (NBP2-85295).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MKRN3 Antibody (NBP2-85295) (0)

There are no reviews for MKRN3 Antibody (NBP2-85295). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MKRN3 Antibody (NBP2-85295) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MKRN3 Products

Array NBP2-85295

Bioinformatics Tool for MKRN3 Antibody (NBP2-85295)

Discover related pathways, diseases and genes to MKRN3 Antibody (NBP2-85295). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MKRN3 Antibody (NBP2-85295)

Discover more about diseases related to MKRN3 Antibody (NBP2-85295).
 

Pathways for MKRN3 Antibody (NBP2-85295)

View related products by pathway.

PTMs for MKRN3 Antibody (NBP2-85295)

Learn more about PTMs related to MKRN3 Antibody (NBP2-85295).
 

Research Areas for MKRN3 Antibody (NBP2-85295)

Find related products by research area.

Blogs on MKRN3

There are no specific blogs for MKRN3, but you can read our latest blog posts.
Coronavirus Brochure

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MKRN3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MKRN3