MKP-3/DUSP6 Antibody (1V5L10)

Western Blot: MKP-3/DUSP6 Antibody (1V5L10) [NBP3-15252] - Analysis of extracts of various cell lines, using MKP-3/DUSP6 Rabbit mAb (NBP3-15252) at 1:1000 dilution. Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) at 1:10000 dilution. Lysates/proteins: 25ug per lane. Blocking buffer: 3% nonfat dry milk in TBST. Detection: ECL Basic Kit. Exposure time: 3min.

Immunohistochemistry-Paraffin: MKP-3/DUSP6 Antibody (1V5L10) [NBP3-15252] - Human colon using MKP-3/DUSP6 Rabbit mAb (NBP3-15252) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry: MKP-3/DUSP6 Antibody (1V5L10) [MKP-3/DUSP6] - Immunohistochemistry analysis of paraffin-embedded Human pancreas tissue using MKP-3/DUSP6 Rabbit mAb at a dilution of 1:500 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Western Blot: MKP-3/DUSP6 Antibody (1V5L10) [MKP-3/DUSP6] - Western blot analysis of various lysates using MKP-3/DUSP6 Rabbit mAb at 1:1000 dilution incubated at room temperature for 1.5 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 90s.

Western Blot: MKP-3/DUSP6 Antibody (1V5L10) [MKP-3/DUSP6] - Western blot analysis of various lysates using MKP-3/DUSP6 Rabbit mAb at 1:1000 dilution incubated at room temperature for 1.5 hours.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25 ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit .Exposure time: 45s.

• Reactivity: Hu, Mu, Rt
• Applications: WB, IHC
• Clone: 1V5L10
• Clonality: Monoclonal
• Host: Rabbit
• Conjugate: Unconjugated

MKP-3/DUSP6 Antibody (1V5L10) Summary

• Additional Information: Recombinant Monoclonal Antibody
• Immunogen: A synthetic peptide corresponding to a sequence within amino acids 282-381 of human MKP-3/DUSP6 (Q16828). ARGKNCGVLVHCLAGISRSVTVTVAYLMQKLNLSMNDAYDIVKMKKSNISPNFNFMGQLLDFERTLGLSSPCDNRVPAQQLYFTTPSNQNVYQVDSLQST
• Isotype: IgG
• Clonality: Monoclonal
• Host: Rabbit
• Gene: DUSP6
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Immunohistochemistry 1:50 - 1:200
  • Immunohistochemistry-Paraffin
  • Western Blot 1:500 - 1:1000

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol, 0.05% BSA
• Preservative: 0.02% Sodium Azide
• Purity: Affinity purified

Alternate Names for MKP-3/DUSP6 Antibody (1V5L10)

• dual specificity phosphatase 6
• Dual specificity protein phosphatase PYST1
• DUSP6
• EC 3.1.3.16
• EC 3.1.3.48
• MAP kinase phosphatase 3
• Mitogen-activated protein kinase phosphatase 3
• MKP3
• MKP-3
• MKP3serine/threonine specific protein phosphatase
• PYST1
• PYST1dual specificity protein phosphatase 6

Background

DUSP6 is encoded by this gene is a member of the dual specificity protein phosphatase subfamily. These phosphatases inactivate their target kinases by dephosphorylating both the phosphoserine/threonine and phosphotyrosine residues. They negatively regulate members of the mitogen-activated protein (MAP) kinase superfamily (MAPK/ERK, SAPK/JNK, p38), which are associated with cellular proliferation and differentiation. Different members of the family of dual specificity phosphatases show distinct substrate specificities for various MAP kinases, different tissue distribution and subcellular localization, and different modes of inducibility of their expression by extracellular stimuli. This gene product inactivates ERK2, is expressed in a variety of tissues with the highest levels in heart and pancreas, and unlike most other members of this family, is localized in the cytoplasm. Two transcript variants encoding different isoforms have been found for this gene.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: DUSP6