MKK3/MEK3 Antibody (8U2X3) Summary
| Additional Information |
Recombinant Monoclonal Antibody |
| Immunogen |
Recombinant fusion protein containing a sequence corresponding to amino acids 150-347 of human MKK3/MEK3 (P46734). FYRKVLDKNMTIPEDILGEIAVSIVRALEHLHSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTMDAGCKPYMAPERINPELNQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADRFSPEFVDFTAQCLRKNPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS |
| Source |
HEK293 |
| Isotype |
IgG |
| Clonality |
Monoclonal |
| Host |
Rabbit |
| Gene |
MAP2K3 |
| Purity |
Affinity purified |
| Innovator's Reward |
Test in a species/application not listed above to receive a full credit towards a future purchase. |
Applications/Dilutions
| Dilutions |
- Immunocytochemistry/ Immunofluorescence 1:50 - 1:200
- Western Blot 1:500 - 1:1000
|
Packaging, Storage & Formulations
| Storage |
Store at -20C. Avoid freeze-thaw cycles. |
| Buffer |
PBS (pH 7.3), 50% glycerol, 0.05% BSA |
| Preservative |
0.02% Sodium Azide |
| Purity |
Affinity purified |
Alternate Names for MKK3/MEK3 Antibody (8U2X3)
Background
Mitogen-acitvated protein kinase kinase 3 (MKK3) belongs to the serine/threonine protein kinase family and the MAPK kinase subfamily (MAP2K, MKK or MEKs). MAPKs require dual phosphorylation on threonine and tyrosine residues, an activation step carried out by MAPK kinase (1-2). MKK3, closely related to MKK6, efficiently phosphorylates and activates p38 MAP kinase in response to inflammatory cytokines and environmental stress but not JNK or ERK (3). MKK3 is activated by mitogenic and environ-mental stress stimulus as well as by insulin. MKK3 is necessary for the expression of glucose transporter and participates in the MAP kinase- mediated signaling cascade (4).
Limitations
This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are
guaranteed for 1 year from date of receipt.
Customers Who Viewed This Item Also Viewed...
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, WB
Species: Hu, Mu, Rt
Applications: IHC, KO, Simple Western, WB
Species: Ca, Hu, Mu, Rt
Applications: CyTOF-ready, Flow, ICC/IF, IHC, IHC-P, IP, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: PEP-ELISA, WB
Species: Hu, Mu, Rt
Applications: Flow, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, S-ELISA, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ELISA
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu
Applications: BA
Species: Hu
Applications: ELISA, Flow, ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC, IHC-P, WB
Species: Hu, Mu
Applications: CyTOF-ready, Flow, ICC, IHC, Simple Western, WB
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
Publications for MKK3/MEK3 Antibody (NBP3-16163) (0)
There are no publications for MKK3/MEK3 Antibody (NBP3-16163).
By submitting your publication information earn gift cards and discounts for future purchases.
Reviews for MKK3/MEK3 Antibody (NBP3-16163) (0)
There are no reviews for MKK3/MEK3 Antibody (NBP3-16163).
By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
- Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
- Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
Product General Protocols
Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.
Video Protocols
FAQs for MKK3/MEK3 Antibody (NBP3-16163) (0)
Secondary Antibodies
| |
Isotype Controls
|
Additional MKK3/MEK3 Products
Research Areas for MKK3/MEK3 Antibody (NBP3-16163)
Find related products by research area.
|
Blogs on MKK3/MEK3