Mitofusin 1 Recombinant Protein Antigen

Product Discontinued

Mitofusin 1 Recombinant Protein Antigen Summary

• Description: A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Mitofusin 1.

  Source: E. coli

  Amino Acid Sequence: SLGWSSLVHRFLGPRNAQRVLLGLSEPIFQLPRSLASTPTAPTTPATPDNASQEELMITLVTGL

  Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

  This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

• Source: E. coli
• Protein/Peptide Type: Recombinant Protein Antigen
• Gene: MFN1
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

• Dilutions:
  • Antibody Competition 10 - 100 molar excess
• Application Notes: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-57125.

  It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

  For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

• Theoretical MW: 24 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 1M Urea, pH 7.4.
• Preservative: No Preservative
• Purity: >80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Mitofusin 1 Recombinant Protein Antigen

• DKFZp762F247
• EC 3.6.5
• EC 3.6.5.-
• FLJ20693
• Fzo homolog
• hfzo1
• hfzo2
• MFN1
• MGC41806
• mitochondrial transmembrane GTPase Fzo-1
• mitochondrial transmembrane GTPase FZO-2
• Mitofusin 1
• mitofusin-1
• putative transmembrane GTPase
• Transmembrane GTPase MFN1

Background

MFN1 (Mitofusin-1) is a nuclear encoded mitochondrial membrane protein that mediates mitochondrial fusion and morphology in mammalian cells. MFN1 and MFN2 are homologs of the Drosophila protein Fuzzy Onion (Fzo) that interact with each other to facilitate mitochondrial targeting. MFN1 is ubiquitously expressed,with slightly higher leves detectedl in kidney and heart. MFN2 may be overexpressed in some tumors, such as lung cancers.

Mitochondrial fusion occurs in many cell types and is a fundamental component of mitochondria morphology, which is balanced between fusion and fission. Mitochondrial dysfunction is a major cause of neuronal death in degenerative disorders, such as Parkinson's disease, and can be triggered by an imbalance in the dynamic equilibrium between mitochondrial fission and fusion.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Bioinformatics

• Gene Symbol: MFN1