Mitochondrial ribonuclease P protein 3 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Mitochondrial ribonuclease P protein 3 Antibody [NBP2-13619] - Immunofluorescent staining of human cell line MCF7 shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: Mitochondrial ribonuclease P protein 3 Antibody [NBP2-13619] - Staining of human rectum shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Mitochondrial ribonuclease P protein 3 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: SYVSLFLADRCGIRNQQRLFSLKTMSPQNTKATNLIAKARYLRKDEGSNK QVYSVPHFFLAGAAKERSQMNSQTEDHALAPVRNTIQLPTQPLNSEEWDK LKEDLKENTGKTSFESWIISQMAGCHSSIDVAKSLLAW
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
KIAA0391
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1-4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Mitochondrial ribonuclease P protein 3 Protein (NBP2-13619PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Mitochondrial ribonuclease P protein 3 Antibody

  • KIAA0391
  • mitochondrial ribonuclease P protein 3
  • MRPP3Mitochondrial RNase P protein 3

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-33538
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-33293
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-02118
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
H00057492-M01
Species: Hu
Applications: WB, ELISA, ICC/IF, IHC, IHC-P
NBP1-83654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP2-45738
Species: Hu
Applications: WB, IHC
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P
NBP1-81493
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13619
Species: Hu
Applications: ICC/IF, IHC, IHC-P

Publications for Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619) (0)

There are no publications for Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619) (0)

There are no reviews for Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Mitochondrial ribonuclease P protein 3 Products

Bioinformatics Tool for Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619)

Discover related pathways, diseases and genes to Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619)

Discover more about diseases related to Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619).
 

Pathways for Mitochondrial ribonuclease P protein 3 Antibody (NBP2-13619)

View related products by pathway.

Blogs on Mitochondrial ribonuclease P protein 3

There are no specific blogs for Mitochondrial ribonuclease P protein 3, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mitochondrial ribonuclease P protein 3 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KIAA0391