FAM177A1 Antibody

Images

 
Western Blot: FAM177A1 Antibody [NBP2-33294] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line HepG2
Immunohistochemistry: FAM177A1 Antibody [NBP2-33294] - Staining of human prostate shows strong cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

FAM177A1 Antibody Summary

Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ESAGQMSNERGFENVELGVIGKKKKVPRRVIHFVSGETMEEYSTDEDEVDGVEKKDV
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
FAM177A1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:200 - 1:500
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.
Control Peptide
FAM177A1 Protein (NBP2-33294PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (86%), Rat (86%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for FAM177A1 Antibody

  • C14orf24
  • chromosome 14 open reading frame 24
  • DKFZp686J1254
  • family with sequence similarity 177, member A1
  • FLJ38854
  • hypothetical protein LOC283635

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-13619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-33538
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
H00001032-M08
Species: Hu
Applications: WB, ELISA, IP
NBP1-89296
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-87377
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF4937
Species: Hu
Applications: WB, IHC
NBP1-33581
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NB200-106
Species: Mu
Applications: WB, ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
NBP2-34294
Species: Hu, Mu, Rt
Applications: WB, Flow, IHC-P

Publications for FAM177A1 Antibody (NBP2-33294) (0)

There are no publications for FAM177A1 Antibody (NBP2-33294).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for FAM177A1 Antibody (NBP2-33294) (0)

There are no reviews for FAM177A1 Antibody (NBP2-33294). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for FAM177A1 Antibody (NBP2-33294) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional FAM177A1 Products

Bioinformatics Tool for FAM177A1 Antibody (NBP2-33294)

Discover related pathways, diseases and genes to FAM177A1 Antibody (NBP2-33294). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for FAM177A1 Antibody (NBP2-33294)

Discover more about diseases related to FAM177A1 Antibody (NBP2-33294).

Research Areas for FAM177A1 Antibody (NBP2-33294)

Find related products by research area.

Blogs on FAM177A1

There are no specific blogs for FAM177A1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our FAM177A1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol FAM177A1
Uniprot