RG9MTD1 Antibody

Images

 
Western Blot: RG9MTD1 Antibody [NBP1-83654] - Analysis in human cell line SCLC-21H.
Immunocytochemistry/ Immunofluorescence: RG9MTD1 Antibody [NBP1-83654] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.
Immunohistochemistry-Paraffin: RG9MTD1 Antibody [NBP1-83654] - Staining of human stomach shows moderate nuclear and cytoplasmic positivity in glandular cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ICC/IF, IHC, IHC-P, IP
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

RG9MTD1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
TRMT10C
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:500
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Immunoprecipitation
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunoprecipitation reported in scientific literature (PMID 23990920)
Control Peptide
RG9MTD1 Protein (NBP1-83654PEP)
Publications
Read Publication using
NBP1-83654 in the following applications:

  • IP
    1 publication

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for RG9MTD1 Antibody

  • EC 2.1.1
  • EC 2.1.1.-
  • EC 2.1.1.36
  • FLJ20432
  • HBV pre-S2 trans-regulated protein 2
  • Mitochondrial RNase P protein 1
  • MRPP1mitochondrial ribonuclease P protein 1
  • NY-REN-49 antigen
  • Renal carcinoma antigen NY-REN-49
  • RNA (guanine-9-) methyltransferase domain containing 1
  • RNA (guanine-9-)-methyltransferase domain-containing protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-84620
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-13619
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-81493
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-83654
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP

Publications for RG9MTD1 Antibody (NBP1-83654)(1)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 1 application: IP.


Filter By Application
IP
(1)
All Applications
Filter By Species
Human
(1)
All Species

Reviews for RG9MTD1 Antibody (NBP1-83654) (0)

There are no reviews for RG9MTD1 Antibody (NBP1-83654). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol
ICC/IF Video Protocol

FAQs for RG9MTD1 Antibody (NBP1-83654) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional RG9MTD1 Products

Bioinformatics Tool for RG9MTD1 Antibody (NBP1-83654)

Discover related pathways, diseases and genes to RG9MTD1 Antibody (NBP1-83654). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Blogs on RG9MTD1

There are no specific blogs for RG9MTD1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our RG9MTD1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol TRMT10C