![Western Blot: RG9MTD1 Antibody [NBP1-83654] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.](http://images.novusbio.com/fullsize2/RG9MTD1-Antibody-Western-Blot-NBP1-83654-img0009.jpg "Western Blot: RG9MTD1 Antibody [NBP1-83654] - Analysis in A-431 cells transfected with control siRNA, target specific siRNA probe #1,. Remaining relative intensity is presented. Loading control: Anti-PPIB.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC, IP, KD |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: SVSVNFFRPFTRFLVPFTLHRKRNNLTILQRYMSSKIPAVTYPKNESTPPSEELELDKWKTTMKSSVQEECVSTISSSKDEDPLAATR |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | TRMT10C |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. Use in Immunoprecipitation reported in scientific literature (PMID 23990920) |
||
| Control Peptide |
|
||
| Publications |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
| Publication using NBP1-83654 | Applications | Species |
|---|---|---|
| Wu H, Sun H, Liang X, Lima WF, Crooke ST. Human RNase H1 Is Associated with Protein P32 and Is Involved in Mitochondrial Pre-rRNA Processing. PLoS One. 2013-08-22 [PMID: 23990920] (IP, Human) | IP | Human |
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | TRMT10C |
![Immunocytochemistry/Immunofluorescence: RG9MTD1 Antibody [NBP1-83654] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.](http://images.novusbio.com/fullsize2/RG9MTD1-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-83654-img0008.jpg "Immunocytochemistry/Immunofluorescence: RG9MTD1 Antibody [NBP1-83654] - Immunofluorescent staining of human cell line U-2 OS shows localization to nucleoplasm & mitochondria.")
![Immunoprecipitation: RG9MTD1 Antibody [NBP1-83654] - P32 can be co-immunoprecipitated with mitochondrial RNase P protein. Immunoprecipitation using MRPP1 antibody (RG9MTD1) or RPL5 antibody was performed as described in materials and methods. Co-isolated proteins were separated by SDS-PAGE, and P32 protein was determined by western analysis. (-) AB, control immunoprecipitation in the absence of antibody. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0071006), licensed under a CC-BY license.](http://images.novusbio.com/fullsize2/RG9MTD1-Antibody-Immunoprecipitation-NBP1-83654-img0010.jpg "Immunoprecipitation: RG9MTD1 Antibody [NBP1-83654] - P32 can be co-immunoprecipitated with mitochondrial RNase P protein. Immunoprecipitation using MRPP1 antibody (RG9MTD1) or RPL5 antibody was performed as described in materials and methods. Co-isolated proteins were separated by SDS-PAGE, and P32 protein was determined by western analysis. (-) AB, control immunoprecipitation in the absence of antibody. Image collected and cropped by CiteAb from the following publication (//dx.plos.org/10.1371/journal.pone.0071006), licensed under a CC-BY license.")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images2/Goat-anti-Rabbit-IgG-(H+L)-Secondary-Antibody-[HRP]-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images2/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")