![Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88944] - Staining in human testis and pancreas tissues using anti-MIS18A antibody. Corresponding MIS18A RNA-seq data are presented for the same tissues.](http://images.novusbio.com/fullsize/MIS18A-Antibody-Immunohistochemistry-Paraffin-NBP1-88944-img0009.jpg "Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88944] - Staining in human testis and pancreas tissues using anti-MIS18A antibody. Corresponding MIS18A RNA-seq data are presented for the same tissues.")
| Reactivity | HuSpecies Glossary |
| Applications | WB, ICC/IF, IHC |
| Clonality | Polyclonal |
| Host | Rabbit |
| Conjugate | Unconjugated |
| Format | BSA Free |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: MAGVRSLRCSRGCAGGCECGDKGKCSDSSLLGKRLSEDSSRHQLLQKWASMWSSMSEDASVADMERAQLEEEAAAAEERPLVF |
| Isotype | IgG |
| Clonality | Polyclonal |
| Host | Rabbit |
| Gene | MIS18A |
| Purity | Immunogen affinity purified |
| Innovator's Reward | Test in a species/application not listed above to receive a full credit towards a future purchase. |
| Dilutions |
|
||
| Application Notes | For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. |
||
| Control Peptide |
|
| Storage | Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
| Buffer | PBS (pH 7.2) and 40% Glycerol |
| Preservative | 0.02% Sodium Azide |
| Purity | Immunogen affinity purified |
![Western Blot RFC1 Antibody [Unconjugated]](https://images.novusbio.com/images2/RFC1_AF6457_Western_Blot_9874.jpg)
Secondary Antibodies |
Isotype Controls |
The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.
| Gene Symbol | MIS18A |
![Western Blot: MIS18A Antibody [NBP1-88944] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line NTERA-2](http://images.novusbio.com/fullsize/MIS18A-Antibody-Western-Blot-NBP1-88944-img0006.jpg "Western Blot: MIS18A Antibody [NBP1-88944] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10Lane 2: Human cell line NTERA-2")
![Immunocytochemistry/Immunofluorescence: MIS18A Antibody [NBP1-88944] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.](http://images.novusbio.com/fullsize/MIS18A-Antibody-Immunocytochemistry-Immunofluorescence-NBP1-88944-img0007.jpg "Immunocytochemistry/Immunofluorescence: MIS18A Antibody [NBP1-88944] - Staining of human cell line U-2 OS shows localization to nucleus & cytosol. Antibody staining is shown in green.")
![Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88944] - Staining of human pancreas shows low expression as expected.](http://images.novusbio.com/fullsize/MIS18A-Antibody-Immunohistochemistry-Paraffin-NBP1-88944-img0008.jpg "Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88944] - Staining of human pancreas shows low expression as expected.")
![Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88944] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.](http://images.novusbio.com/fullsize/MIS18A-Antibody-Immunohistochemistry-Paraffin-NBP1-88944-img0005.jpg "Immunohistochemistry-Paraffin: MIS18A Antibody [NBP1-88944] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts.")
![Immunocytochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/Insulin_MAB1417_Immunocytochemistry_9376.jpg)
![Immunohistochemistry Insulin Antibody (182410) [Unconjugated]](https://images.novusbio.com/images2/mab1417_human-bovine-mouse-insulin-mab-clone-182410-immunohistochemistry-308202115145.jpg)
![Western Blot IRS2 Antibody (676415) [Unconjugated]](https://images.novusbio.com/images2/IRS2_MAB6347_Western_Blot_11857.jpg)
![Insulysin/IDE [Unconjugated]](/sites/all/modules/enterprise-tech/et_datasheets/images/novus_guarantee.png "Insulysin/IDE [Unconjugated]")
![Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).](https://images.novusbio.com/images/Goat-anti-Rabbit-IgG-H+L-Secondary-Antibody-HRP-Western-Blot-NB7160-img0001.jpg "Western Blot: Goat anti-Rabbit IgG (H+L) Secondary Antibody [HRP] [NB7160] - Western blot showing vemurafenib treatment in BRAFV600E CRC cells inhibits fission mediator DRP1 with no significant effect on fusion proteins (Mfn1 & 2) using MFN-1 antibody (NBP1-51841) and corresponding secondary antibody, goat anti-rabbit IgG-HRP (NB7160). Image collected and cropped by CiteAb from the following publication (https://pubmed.ncbi.nlm.nih.gov/33738242).")
![Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.](https://images.novusbio.com/images/Rabbit--Mouse-IgG-Isotype-Control-Flow-Cytometry-NBP2-24891-img0001.jpg "Flow Cytometry: Rabbit IgG Isotype Control [NBP2-24891] - Intracellular FACS analysis of mouse TLR6 polyclonal antibody (red), rabbit isotype control (green), RAW cells alone (shaded). Two micrograms of antibodies were used. Goat anti-rabbit FITC (Novus, 20302) was used as secondary.")