OIP5 Antibody - BSA Free

Western Blot: OIP5 Antibody [NBP2-13688] - Analysis in human cell line K562.

Immunocytochemistry/Immunofluorescence: OIP5 Antibody [NBP2-13688] - Staining of human cell line PC-3 shows localization to nucleoplasm & cytosol. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human tonsil shows no positivity in germinal center cells as expected.

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Analysis in human testis and prostate tissues. Corresponding OIP5 RNA-seq data are presented for the same tissues.

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human pancreas shows no positivity in exocrine glandular cells as expected.

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human prostate shows no positivity in glandular cells as expected.

Immunohistochemistry-Paraffin: OIP5 Antibody [NBP2-13688] - Staining of human testis shows strong positivity in acrosomes.

• Reactivity: Hu
• Applications: WB, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

OIP5 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit OIP5 Antibody - BSA Free (NBP2-13688) is a polyclonal antibody validated for use in IHC, WB and ICC/IF. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: CGSCGIPVGFHLYSTHAALAALRGHFCLSSDKMVCYLLKTKAIVNASEMDIQNVPLSEKIAELKEKIVLTHNRLKSLMKILSEVT
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: OIP5
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:10-1:500
  • Immunohistochemistry-Paraffin 1:50-1:200
  • Western Blot 0.04 - 0.4 ug/ml
• Application Notes: For IHC-Paraffin, HIER pH 6 retrieval is recommended. ICC/IF Fixation Permeabilization: Use PFA/Triton X-100.
• Control Peptide:

  OIP5 Protein (NBP2-13688PEP)

Reactivity Notes

Rat (80%).

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for OIP5 Antibody - BSA Free

• Cancer/testis antigen 86
• CT865730547N13Rik
• hMIS18beta
• LAP2alpha interactor-25
• LINT-25
• MIS18B
• MIS18beta
• OIP-5
• Opa interacting protein 5
• Opa-interacting protein 5
• protein Mis18-beta

Background

Commonly referred to as OIP5, Opa interacting protein 5 is essential to protein binding. More specifically, OIP5 is necessary for the recruitment of CENPA to centromeres and normal chromosome segregation during mitosis. OIP5 interacts with other proteins such as RAF1, BRAF, CENPA, CENPN, and HJURP and also binds UBC, TMPO, MIS18A, CASP10 and RARG.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: OIP5