MIS18A Antibody

Images

 
Western Blot: MIS18A Antibody [NBP1-88943] - Lane 1: Marker [kDa] 250, 130, 100, 70, 55, 35, 25, 15, 10. Lane 2: NTERA-2 High
Immunohistochemistry: MIS18A Antibody [NBP1-88943] - Staining of human testis shows strong nuclear positivity in cells in seminiferus ducts. Sertoli cells are generally negative.
Simple Western: MIS18A Antibody [NBP1-88943] - Simple Western lane view shows a specific band for MIS18A in 0.2 mg/ml of Ntera-2 (left) and h. Testis (right) lysate(s). This experiment was performed under reducing ...read more
Simple Western: MIS18A Antibody [NBP1-88943] - Electropherogram image of the corresponding Simple Western lane view. MIS18A antibody was used at 1:25 dilution on Ntera-2 and h. Testis lysate(s) respectively.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, Simple Western, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MIS18A Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:KNLDYKRDLFCLSVEAIESYVLGSSEKQIVSEDKELFNLESRVEIEKSLTQMEDVLKALQMKLWEAESKLSFATC
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIS18A
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100 - 1:250
  • Simple Western 1:25
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended.

In Simple Western only 10 - 15 uL of the recommended dilution is used per data point. Separated by Size.
Control Peptide
MIS18A Protein (NBP1-88943PEP)

Reactivity Notes

Expected species cross reactivity based on sequence homology: Mouse (84%)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MIS18A Antibody

  • B28
  • C21orf45
  • C21orf46
  • FAPP1-associated protein 1
  • FASP1
  • hMis18alpha
  • MIS18 kinetochore protein homolog A (S. pombe)
  • MIS18alpha
  • protein Mis18-alpha

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-34260
Species: Hu, Mu, Po, Bv, Rb
Applications: WB, Flow, ICC/IF, IHC-Fr, IHC-P, IP, PAGE
NBP2-13608
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-28140
Species: Mu
Applications: WB, Flow, IHC, IHC-Fr, IP
NBP2-12892
Species: Hu
Applications: WB, ICC/IF
MAB5756
Species: Hu
Applications: Flow
NBP1-89905
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-00768
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-88941
Species: Hu
Applications: IHC, IHC-P
NBP2-13688
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2688
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Flow-CS
NBP1-88933
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
NBP1-92172
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
AF6347
Species: Hu
Applications: WB
NBP2-25196
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, In vitro, CyTOF-ready
NBP2-12793
Species: Hu, Mu
Applications: WB, IP
NBP2-45570
Species: Hu
Applications: WB, Flow, IHC
NB100-230
Species: Hu
Applications: WB, IP, PLA
NBP2-14871
Species: Hu, Mu
Applications: WB, ICC/IF
NB110-61646
Species: Hu
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP

Publications for MIS18A Antibody (NBP1-88943) (0)

There are no publications for MIS18A Antibody (NBP1-88943).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIS18A Antibody (NBP1-88943) (0)

There are no reviews for MIS18A Antibody (NBP1-88943). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MIS18A Antibody (NBP1-88943) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MIS18A Products

Bioinformatics Tool for MIS18A Antibody (NBP1-88943)

Discover related pathways, diseases and genes to MIS18A Antibody (NBP1-88943). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Pathways for MIS18A Antibody (NBP1-88943)

View related products by pathway.

PTMs for MIS18A Antibody (NBP1-88943)

Learn more about PTMs related to MIS18A Antibody (NBP1-88943).

Blogs on MIS18A

There are no specific blogs for MIS18A, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIS18A Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIS18A