MIS12 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: MIS12 Antibody [41880002] - This image is specific to animal number SDQ2966 Methanol fixation; 1hr
Immunocytochemistry/ Immunofluorescence: MIS12 Antibody [41880002] - This image is specific to animal number SDQ2965 Methanol fixation; 1 hr

Product Details

Summary
Reactivity CeSpecies Glossary
Applications ELISA, ICC/IF
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Concentration
1 mg/ml

Order Details

MIS12 Antibody Summary

Immunogen
In vivo generated recombinant protein fragment
Epitope
IASAKEHKSLKQVEKEFDEKLEKIRQLRIKLAKRHDELEAVNNAIEVLHVMEKSQEQLISQKRIVPDSPTRMSPV
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MIS12
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • ELISA 1:100-1:2000
  • Immunocytochemistry/Immunofluorescence 1:10-1:2000
Application Notes
This product is useful for ELISA and for Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
Preservative
No Preservative
Concentration
1 mg/ml
Purity
Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for MIS12 Antibody

  • 2510025F08Rik
  • hMis12
  • homolog of yeast Mis12
  • KNTC2AP
  • MGC2488
  • MIS12 homolog
  • MIS12, MIND kinetochore complex component, homolog (S. pombe)
  • MIS12, MIND kinetochore complex component, homolog (yeast)
  • MTW1
  • protein MIS12 homolog

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12892
Species: Hu
Applications: WB, ICC/IF
NB100-338
Species: Hu, Mu, Rt, Po, Ha, Mk
Applications: WB, Flow, ICC/IF, IHC, IP
NB100-2586
Species: Hu, Mu
Applications: WB, IHC-P, IP
NBP2-55474
Species: Hu
Applications: ICC/IF
H00002491-B01P
Species: Hu
Applications: WB, ICC/IF
NBP1-82546
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-88302
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-32281
Species: Hu, Mu, Rt
Applications: WB, ICC/IF
NB100-2364
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P, IP
NBP1-31632
Species: Hu
Applications: WB, ICC/IF
H00151648-M01
Species: Hu
Applications: WB, ELISA, IP
NB100-353
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IP, CyTOF-ready
NB110-40623
Species: Hu
Applications: WB, ChIP, IHC, IHC-P, IP, PLA
NBP2-27562
Species: Hu
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-47264
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-294
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
H00000699-D01P
Species: Hu, Mu
Applications: WB, ICC/IF, PLA
NBP2-47263
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB100-2369
Species: Hu
Applications: ICC/IF, IHC
NBP2-37471
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-P, CyTOF-ready
Supplier Logo

Publications for MIS12 Antibody (41880002) (0)

There are no publications for MIS12 Antibody (41880002).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MIS12 Antibody (41880002) (0)

There are no reviews for MIS12 Antibody (41880002). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for MIS12 Antibody (41880002) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional MIS12 Products

Bioinformatics Tool for MIS12 Antibody (41880002)

Discover related pathways, diseases and genes to MIS12 Antibody (41880002). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MIS12 Antibody (41880002)

Discover more about diseases related to MIS12 Antibody (41880002).
 

Pathways for MIS12 Antibody (41880002)

View related products by pathway.

PTMs for MIS12 Antibody (41880002)

Learn more about PTMs related to MIS12 Antibody (41880002).
 

Research Areas for MIS12 Antibody (41880002)

Find related products by research area.

Blogs on MIS12

There are no specific blogs for MIS12, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MIS12 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MIS12
Entrez
Uniprot