MIS12 Antibody

Immunocytochemistry/Immunofluorescence: MIS12 Antibody [41880002] - This image is specific to animal number SDQ2966 Methanol fixation; 1hr

Immunocytochemistry/Immunofluorescence: MIS12 Antibody [41880002] - This image is specific to animal number SDQ2965 Methanol fixation; 1 hr

Product Discontinued

MIS12 Antibody Summary

• Immunogen: In vivo generated recombinant protein fragment
• Epitope: IASAKEHKSLKQVEKEFDEKLEKIRQLRIKLAKRHDELEAVNNAIEVLHVMEKSQEQLISQKRIVPDSPTRMSPV
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MIS12
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA 1:100-1:2000
  • Immunocytochemistry/ Immunofluorescence 1:10-1:2000
• Application Notes: This product is useful for ELISA and for Immunofluorescence.

Reactivity Notes

Caenorhabditis elegans

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: 20mM Potassium Phosphate (pH 7.0) and 0.15M NaCl
• Preservative: No Preservative
• Concentration: 1 mg/ml
• Purity: Immunogen affinity purified

Notes

This product was created from the ModEncode Project, a part of the NHGRI, and is sold by SDIX and Novus Biologicals. These C. elegans antibodies were generated in the labs of Jason Lieb, Susan Strome, Julie Ahringer, Arshad Desai, and Abby Dernburg.

Alternate Names for MIS12 Antibody

• 2510025F08Rik
• hMis12
• homolog of yeast Mis12
• KNTC2AP
• MGC2488
• MIS12 homolog
• MIS12, MIND kinetochore complex component, homolog (S. pombe)
• MIS12, MIND kinetochore complex component, homolog (yeast)
• MTW1
• protein MIS12 homolog

Background

Part of the MIS12 complex which is required for normal chromosome alignment and segregation and forkinetochore formation during mitosis

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MIS12
• Entrez:
  • 171927(C. elegans)
• Uniprot:
  • Y47G6A.24(C. elegans)