MIS RII/AMHR2 Antibody - BSA Free

Western Blot: MIS RII/AMHR2 Antibody [NBP3-09957] - Western blot analysis of MIS RII/AMHR2 in 721_B Whole Cell lysates. Antibody dilution at 1.0ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MIS RII/AMHR2 Antibody - BSA Free Summary

• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human MIS RII/AMHR2. Peptide sequence VRGEPVPEPRPDSGRDWSVELQELPELCFSQVIREGGHAVVWAGQLQGKL
• Clonality: Polyclonal
• Host: Rabbit
• Gene: AMHR2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml
• Theoretical MW: 63 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MIS RII/AMHR2 Antibody - BSA Free

• AMH type II receptor
• AMHR2
• AMHREC 2.7.11.30
• AMHRII
• C14
• MIS RII
• MISR2
• MISRII
• MISRIIMIS type II receptor
• MRII
• Muellerian hormone type II receptor
• Muellerian hormone type-2 receptor
• Mullerian hormone receptor, type II
• Mullerian inhibiting substance type II receptor

Background

AMHR2 is a serine/threonine kinase with a single transmembrane domain belonging to the family of type II receptors for TGF-beta-related proteins that is expressed in fetal and adult gonads of both sexes. Anti-Mullerian hormone (AMH) and its receptor are involved in the regression of Mullerian ducts in male fetuses. Male sex differentiation is mediated by 2 discrete hormones produced by the fetal testis. Testosterone, produced by Leydig cells, virilizes the external genitalia and promotes prostatic growth; anti-Mullerian hormone (AMH) results in regression of Mullerian ducts which would otherwise differentiate into the uterus and fallopian tubes. A number of allelic variants of AMHR2 are associated with persistent mullerian duct syndrome.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: AMHR2