MiRP1 Antibody

Images

 
Western Blot: MiRP1 Antibody [NBP2-85288] - Host: Rabbit. Target Name: KCNE2. Sample Tissue: Human DLD1 Whole Cell lysates. Antibody Dilution: 1ug/ml

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

MiRP1 Antibody Summary

Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MiRP1. Peptide sequence: MVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNL The peptide sequence for this immunogen was taken from within the described region.
Clonality
Polyclonal
Host
Rabbit
Gene
KCNE2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS, 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for MiRP1 Antibody

  • ATFB4
  • cardiac voltage-gated potassium channel accessory subunit 2
  • human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1
  • LQT5
  • LQT6
  • MGC138292
  • MinK-related peptide 1
  • minK-related peptide-1
  • MIRP1
  • Potassium channel subunit beta MiRP1
  • potassium channel subunit, MiRP1
  • potassium voltage-gated channel subfamily E member 2
  • potassium voltage-gated channel, Isk-related family, member 2
  • voltage-gated K+ channel subunit MIRP1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-12897
Species: Hu, Mu, Rt, Ha
Applications: WB, ICC/IF, IHC, IHC-P, IP, MiAr
NBP3-03109
Species: Hu, Mu, Rt
Applications: WB, IHC, IHC-P
H00003753-M01
Species: Hu, Rt, Ca, Gp, Pm
Applications: WB, ELISA, ICC/IF, KD
NB110-61010
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC, IP, RIA, CyTOF-ready
NBP1-32766
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-84125
Species: Hu
Applications: WB, IHC, IHC-P
NBP1-49885
Species: Hu, Mu, Rt, Bv, Ca
Applications: WB, IHC, IHC-P, PEP-ELISA
NBP2-60655
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP1-84730
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-12900
Species: Hu, Mu, Rt, Pm
Applications: WB, ICC/IF, IHC, IHC-P, MiAr
NBP1-85835
Species: Hu
Applications: IHC, IHC-P
NBP2-33863
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-76945
Species: Hu, Mu
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP2-75552
Species: Hu, Mu, Rt
Applications: WB, Flow, ICC/IF, IHC-P
H00030819-M01
Species: Hu
Applications: WB, ELISA, IHC, IHC-P, KD
NBP2-12895
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-Fr, IP, MiAr
NBP3-03748
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP1-81049
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-85288
Species: Hu
Applications: WB

Publications for MiRP1 Antibody (NBP2-85288) (0)

There are no publications for MiRP1 Antibody (NBP2-85288).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for MiRP1 Antibody (NBP2-85288) (0)

There are no reviews for MiRP1 Antibody (NBP2-85288). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for MiRP1 Antibody (NBP2-85288) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Other Available Formats

Additional MiRP1 Products

Bioinformatics Tool for MiRP1 Antibody (NBP2-85288)

Discover related pathways, diseases and genes to MiRP1 Antibody (NBP2-85288). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for MiRP1 Antibody (NBP2-85288)

Discover more about diseases related to MiRP1 Antibody (NBP2-85288).
 

Pathways for MiRP1 Antibody (NBP2-85288)

View related products by pathway.

PTMs for MiRP1 Antibody (NBP2-85288)

Learn more about PTMs related to MiRP1 Antibody (NBP2-85288).

Blogs on MiRP1

There are no specific blogs for MiRP1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our MiRP1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol KCNE2