MiRP1 Antibody - BSA Free

Western Blot: MiRP1 Antibody [NBP2-85288] - Host: Rabbit. Target Name: KCNE2. Sample Tissue: Human DLD1 Whole Cell lysates. Antibody Dilution: 1ug/ml

• Reactivity: Hu
• Applications: WB
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free
• Concentration: 0.5 mg/ml

MiRP1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MiRP1 Antibody - BSA Free (NBP2-85288) is a polyclonal antibody validated for use in WB. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MiRP1. Peptide sequence: MVMIGMFSFIIVAILVSTVKSKRREHSNDPYHQYIVEDWQEKYKSQILNL The peptide sequence for this immunogen was taken from within the described region.
• Clonality: Polyclonal
• Host: Rabbit
• Gene: KCNE2
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • Western Blot 1.0 ug/ml

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS, 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Concentration: 0.5 mg/ml
• Purity: Affinity purified

Alternate Names for MiRP1 Antibody - BSA Free

• ATFB4
• cardiac voltage-gated potassium channel accessory subunit 2
• human minK-related peptide 1, potassium channel subunit, MiRP110Minimum potassium ion channel-related peptide 1
• LQT5
• LQT6
• MGC138292
• MinK-related peptide 1
• minK-related peptide-1
• MIRP1
• Potassium channel subunit beta MiRP1
• potassium channel subunit, MiRP1
• potassium voltage-gated channel subfamily E member 2
• potassium voltage-gated channel, Isk-related family, member 2
• voltage-gated K+ channel subunit MIRP1

Background

Voltage-gated potassium (Kv) channels represent the most complex class of voltage-gated ion channels from both functional and structural standpoints. Their diverse functions include regulating neurotransmitter release, heart rate, insulin secretion, neuronal excitability, epithelial electrolyte transport, smooth muscle contraction, and cell volume. This gene encodes a member of the potassium channel, voltage-gated, isk-related subfamily. This member is a small integral membrane subunit that assembles with the KCNH2 gene product, a pore-forming protein, to alter its function. This gene is expressed in heart and muscle and the gene mutations are associated with cardiac arrhythmia.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: KCNE2