Migfilin Recombinant Protein Antigen

Images

 
There are currently no images for Migfilin Protein (NBP1-86665PEP).

Every product we sell is backed by Novus' 100% Guarantee. If you have used this product, please submit your images and reviews to earn reward points.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications AC

Order Details

Migfilin Recombinant Protein Antigen Summary

Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human FBLIM1.

Source: E. coli

Amino Acid Sequence: CEPCYQDTLERCGKCGEVVRDHIIRALGQAFHPSCFTCVTCARCIGDESFALGSQNEVYCLDDFYRKFAPVCSICENPIIPRDGKDAFKIECMGRNFHENCYRCEDCRILLSVEPTDQGCYPLNNHLFCKPCHV

Fusion Tag: N-terminal His6ABP (ABP = Albumin Binding Protein derived from Streptococcal Protein G)

This product is intended to be used as a blocking antigen for antibody competition assays. Any other use of this antigen is done at the risk of the user. The use of this product for commercial production is strictly prohibited. Please contact technical support if you have any questions.

Source
E. coli
Protein/Peptide Type
Recombinant Protein Antigen
Gene
FBLIM1
Purity
>80% by SDS-PAGE and Coomassie blue staining

Applications/Dilutions

Dilutions
  • Antibody Competition 10 - 100 molar excess
Application Notes
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP1-86665.

It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml.

For current lot information, including availability, please contact our technical support team click nb-technical@bio-techne.com

Theoretical MW
33 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 1M Urea, pH 7.4.
Preservative
No Preservative
Purity
>80% by SDS-PAGE and Coomassie blue staining

Alternate Names for Migfilin Recombinant Protein Antigen

  • CAL
  • DKFZp434G171
  • FBLP-1FBLP1CSX-associated LIM
  • filamin binding LIM protein 1
  • filamin-binding LIM protein 1
  • filamin-binding LIM protein-1
  • MIG2-interacting protein
  • migfilin
  • mitogen-inducible 2 interacting protein
  • Mitogen-inducible 2-interacting protein

Background

FBLIM1 encodes a protein with an N-terminal filamin-binding domain, a central proline-rich domain, and, multiple C-terminal LIM domains. This protein localizes at cell junctions and may link cell adhesion structures to the actin cytoskeleton. This protein may be involved in the assembly and stabilization of actin-filaments and likely plays a role in modulating cell adhesion, cell morphology and cell motility. This protein also localizes to the nucleus and may affect cardiomyocyte differentiation after binding with the CSX/NKX2-5 transcription factor. Alternative splicing results in multiple transcript variants encoding different isoforms.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-89366
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
H00002770-M01
Species: Hu
Applications: ELISA, IHC,  IHC-P, S-ELISA, WB
NBP3-25228
Species: Hu
Applications: ICC/IF
NBP1-20194
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-87382
Species: Hu
Applications: IHC,  IHC-P, WB
NBP2-20428
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
NBP3-12450
Species: Hu, Mu
Applications: ELISA, IHC,  IHC-P, WB
NBP1-87692
Species: Ha, Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, KD, WB
H00006936-B01P
Species: Hu
Applications: ICC/IF, WB
DY1707
Species: Hu
Applications: ELISA
NBP2-16684
Species: Hu, Mu, Rt
Applications: EM, IHC,  IHC-P, WB
NB300-731
Species: Gp, Hu, Mu, Rb, Rt, Sh, Ye
Applications: B/N, ChIP, Flow, GS, ICC/IF, IHC,  IHC-P, IP, WB
MAB1455
Species: Hu
Applications: CyTOF-ready, Dual ISH-IHC, ICC, IHC, ICFlow, Simple Western, WB
M6000B
Species: Mu
Applications: ELISA
MAB1417
Species: Bv, Hu, Mu
Applications: ICC, IHC
NBP3-15868
Species: Hu, Mu, Rt
Applications: ELISA, ICC/IF, IHC,  IHC-P, WB
AF4928
Species: Hu
Applications: CyTOF-ready, Flow, WB

Publications for Migfilin Protein (NBP1-86665PEP) (0)

There are no publications for Migfilin Protein (NBP1-86665PEP).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Migfilin Protein (NBP1-86665PEP) (0)

There are no reviews for Migfilin Protein (NBP1-86665PEP). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

FAQs for Migfilin Protein (NBP1-86665PEP) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Migfilin Products

Blogs on Migfilin

There are no specific blogs for Migfilin, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Molarity Calculator

Calculate the mass, volume, or concentration required for a solution.

The molarity calculator is based on the following equation:

Mass (g) = Concentration (mol/L) x Volume (L) x Molecular Weight (g/mol)

As an example, if the molecular weight of a compound is 197.13 g/mol and the desired concentration is 10 mM for 10 ml of water based stock solution, the required mass would be = 19.713 (value determined by this calculator).

=
x
x
g/mol

Review this Product

Be the first to review our Migfilin Recombinant Protein Antigen and receive a gift card or discount.

Bioinformatics

Gene Symbol FBLIM1