MIER1 Antibody - BSA Free

Immunohistochemistry: MIER1 Antibody [NBP3-35857] - Immunohistochemistry analysis of paraffin-embedded Mouse kidney using MIER1 Rabbit pAb at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Western Blot: MIER1 Antibody [NBP3-35857] - Western blot analysis of various lysates using MIER1 Rabbit pAb at 1:1000 dilution.Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) at 1:10000 dilution.Lysates/proteins: 25ug per lane.Blocking buffer: 3% nonfat dry milk in TBST.Detection: ECL Basic Kit.Exposure time: 10s.

• Reactivity: Hu, Mu
• Applications: WB, ELISA, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

MIER1 Antibody - BSA Free Summary

• Description: Novus Biologicals Rabbit MIER1 Antibody - BSA Free (NBP3-35857) is a polyclonal antibody validated for use in IHC, WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 110-160 of human MIER1 (Q8N108).
  
  Sequence:
  SGENKEENIKDSSGQEDETQSSNDDPSQSVASQDAQEIIRPRRCKYFDTNS
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MIER1
• Purity: Affinity purified

Applications/Dilutions

• Dilutions:
  • ELISA Recommended starting concentration is 1 μg/mL
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:50 - 1:200
  • Western Blot 1:500 - 1:2000
• Theoretical MW: 58 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.3), 50% glycerol
• Preservative: 0.01% Thimerosal
• Purity: Affinity purified

Alternate Names for MIER1 Antibody - BSA Free

• DKFZp781G0451
• Early response 1
• ER1
• hMI-ER1
• KIAA1610MI-ER1
• mesoderm induction early response 1 (MI-ER1)
• mesoderm induction early response 1 homolog (Xenopus laevis)
• mesoderm induction early response protein 1
• MGC131940
• MGC150640
• MGC150641
• Mi-er1

Background

Transcriptional repressor of a number of genes including Sp1 target genes

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MIER1