MICALL1 Antibody

Product Discontinued

MICALL1 Antibody Summary

• Immunogen: Synthetic peptide directed towards the N terminal of human MICALL1The immunogen for this antibody is MICALL1. Peptide sequence ENGPEEGTFVCAEHCARLGPGTRSGTRPGPFSQPKQQHQQQLAEDAKDVP.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: MICALL1
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence
  • Immunohistochemistry 1:10-1:500
  • Western Blot 1:1000
• Application Notes: This is a rabbit polyclonal antibody against MICALL1 and was validated on Western blot.
• Theoretical MW: 93 kDa.
  Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

• Storage: Store at -20C. Avoid freeze-thaw cycles.
• Buffer: PBS and 2% Sucrose
• Preservative: 0.09% Sodium Azide
• Purity: Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for MICALL1 Antibody

• DKFZp686M2226
• KIAA1668
• MICAL-L1
• MICAL-like 1
• MICAL-like protein 1

Background

MICALL1 may be a cytoskeletal regulator

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MICALL1
• Uniprot:
  • NP_203744(Human)