MICAL3 Antibody (3A6) - Azide and BSA Free

Sandwich ELISA: MICAL3 Antibody (3A6) [H00057553-M08] - Detection limit for recombinant GST tagged MICAL3 is 0.3 ng/ml as a capture antibody.

• Reactivity: Hu
• Applications: WB, ELISA
• Clone: 3A6
• Clonality: Monoclonal
• Host: Mouse
• Conjugate: Unconjugated
• Format: Azide and BSA Free

MICAL3 Antibody (3A6) - Azide and BSA Free Summary

• Description: Novus Biologicals Mouse MICAL3 Antibody (3A6) - Azide and BSA Free (H00057553-M08) is a monoclonal antibody validated for use in WB and ELISA. All Novus Biologicals antibodies are covered by our 100% guarantee.
• Immunogen: MICAL3 (XP_032996.2, 251 a.a. ~ 340 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa. DDQHWSDSPSDADRELRLPCPAEGEAELELRVSEDEEKLPASPKHQERGPSQATSPIRSPQESALLFIPVHSPSTEGPQLPPVPAATQEK
• Specificity: This product is specific for Human MICAL3 monoclonal antibody (M08), clone 3A6 [Gene ID: 57553].
• Isotype: IgG2a Kappa
• Clonality: Monoclonal
• Host: Mouse
• Gene: MICAL3
• Purity: IgG purified

Applications/Dilutions

• Dilutions:
  • ELISA
  • Sandwich ELISA
  • Western Blot
• Application Notes: Mouse monoclonal antibody raised against a partial recombinant MICAL3.

Packaging, Storage & Formulations

• Storage: Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles.
• Buffer: In 1x PBS, pH 7.4
• Preservative: No Preservative
• Purity: IgG purified

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for MICAL3 Antibody (3A6) - Azide and BSA Free

• microtubule associated monoxygenase, calponin and LIM domain containing 3

Background

Associated with spermatid development

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Bioinformatics

• Gene Symbol: MICAL3
• Uniprot:
  • XP_032996.2(Human)