METTL14 Antibody - BSA Free

Images

 
Immunocytochemistry/ Immunofluorescence: METTL14 Antibody [NBP1-81392] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.
Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Staining of human kidney shows moderate to strong nuclear positivity in glomeruli and cells in tubules.
Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.
Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.
Simple Western: METTL14 Antibody [NBP1-81392] - Simple Western lane view shows a specific band for METTL14 in 0.2 mg/ml of NIH-3T3 lysate. This experiment was performed under reducing conditions using the 12-230 kDa ...read more
Knockdown of METTL14 or inhibition of m6A methylation modification can partially rescue the decline in cell proliferation induced by atRA. qRT-PCR (A) and Western blot (B) detection of the siRNA knockdown efficiency of ...read more
Increased m6A level and expression of METTL14 in embryonic palatal mesenchyme were associated with cleft palate. (A) Dot blot was used to detect the m6A modification level of RNA in the palatal mesenchyme of embryonic ...read more
Knockdown of METTL14 or inhibition of m6A methylation modification can partially rescue the decline in cell proliferation induced by atRA. qRT-PCR (A) and Western blot (B) detection of the siRNA knockdown efficiency of ...read more
Increased m6A level and expression of METTL14 in embryonic palatal mesenchyme were associated with cleft palate. (A) Dot blot was used to detect the m6A modification level of RNA in the palatal mesenchyme of embryonic ...read more
Inhibition of mesenchymal cell proliferation in cleft palate mice may be related to the abnormal expression of METTL14. (A) Western blot detection of the proliferation and cell cycle-related differential genes of ...read more

Product Details

Summary
Reactivity Hu, Mu, RtSpecies Glossary
Applications Simple Western, ICC/IF, IHC
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated
Format
BSA Free

Order Details

View Available Formulations
Catalog# & Formulation Size Price

METTL14 Antibody - BSA Free Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
Predicted Species
Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
METTL14
Purity
Affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:20
Application Notes
ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 64 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
Control Peptide
METTL14 Protein (NBP1-81392PEP)
Publications
Read Publications using
NBP1-81392 in the following applications:

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Affinity purified

Alternate Names for METTL14 Antibody - BSA Free

  • EC 2.1.1
  • EC 2.1.1.-
  • KIAA1627
  • KIAA1627methyltransferase-like protein 14
  • methyltransferase like 14
  • METTL14

Background

Probable methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-93882
Species: Hu, Mu, Rt
Applications: ICC/IF, IHC,  IHC-P, WB
H00023435-M01
Species: Ba, Pp, Hu, I, Pm, Mu, Rt
Applications: ELISA, Func, ICC/IF, IHC,  IHC-P, IP, KD, WB
375-TL
Species: Hu
Applications: BA
NBP1-85764
Species: Hu
Applications: IHC,  IHC-P, WB
MAB7325
Species: Hu, Mu, Rt
Applications: IHC, WB
NBP2-33606
Species: Hu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP2-03819
Species: Ca, Hu, Pm, Mu, Rt
Applications: Flow, ICC/IF, IHC,  IHC-P, WB
NBP2-22218
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
AF3758
Species: Hu, Mu
Applications: ICC, KO, Simple Western, WB
NB110-57150
Species: Hu, Mu, Rt
Applications: IHC,  IHC-P, WB
NB100-56363
Species: Hu, Mu
Applications: ICC/IF, IHC,  IHC-P, WB
NBP1-81392
Species: Hu, Mu, Rt
Applications: Simple Western, ICC/IF, IHC

Publications for METTL14 Antibody (NBP1-81392)(10)

We have publications tested in 1 confirmed species: Human.

We have publications tested in 2 applications: ICC/IF, WB.


Filter By Application
ICC/IF
(1)
WB
(4)
All Applications
Filter By Species
Human
(5)
All Species
Showing Publications 1 - 10 of 10.
Publications using NBP1-81392 Applications Species
Xiao L, De Jesus DF, Ju CW, Wei JB et Al. m(6)A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1 Cell Metab 2024-09-10 [PMID: 39255799]
Zhu Y, Zhang Y, Jiang Y et Al. Retinoic Acid Upregulates METTL14 Expression and the m(6)A Modification Level to Inhibit the Proliferation of Embryonic Palate Mesenchymal Cells in Cleft Palate Mice Int J Mol Sci 2024-04-20 [PMID: 38674123]
Foucault, L;Capeliez, T;Angonin, D;Lentini, C;Bezin, L;Heinrich, C;Parras, C;Donega, V;Marcy, G;Raineteau, O; Neonatal brain injury unravels transcriptional and signaling changes underlying the reactivation of cortical progenitors Cell reports 2024-02-12 [PMID: 38349790]
Jian D, Wang Y, Jian L et al. METTL14 aggravates endothelial inflammation and atherosclerosis by increasing FOXO1 N6-methyladeosine modifications Theranostics 2020-07-11 [PMID: 32802173] (Human) Human
Jiang C, Trudeau S. J, et al. CRISPR/Cas9 Screens Reveal Multiple Layers of B cell CD40 Regulation. Cell Rep 2019-07-30 [PMID: 31365872] (WB, Human) WB Human
Winkler R, Gillis E, Lasman L et al. m6A modification controls the innate immune response to infection by targeting type I interferons Nat. Immunol. 2018-12-17 [PMID: 30559377] (WB, Human) WB Human
Zhou J, Wan J, Gao X et al. Dynamic m6A mRNA methylation directs translational control of heat shock response. Nature. 2015-10-12 [PMID: 26458103] (ICC/IF, WB, Human) ICC/IF, WB Human
Liu N, Dai Q, Zheng G et al. N6-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions. Nature 2015-02-26 [PMID: 25719671] (WB, Human) WB Human
Wang Y, Li Y, Toth JI et al. N6-methyladenosine modification destabilizes developmental regulators in embryonic stem cells. Nat Cell Biol 2014-02-01 [PMID: 24394384]
Liu J, Yue Y, Han D et al. A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation. Nat Chem Biol 2014-02-01 [PMID: 24316715]

Reviews for METTL14 Antibody (NBP1-81392) (0)

There are no reviews for METTL14 Antibody (NBP1-81392). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for METTL14 Antibody (NBP1-81392) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional METTL14 Products

Research Areas for METTL14 Antibody (NBP1-81392)

Find related products by research area.

Blogs on METTL14

There are no specific blogs for METTL14, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our METTL14 Antibody - BSA Free and receive a gift card or discount.

Bioinformatics

Gene Symbol METTL14