METTL14 Antibody - BSA Free

Immunocytochemistry/Immunofluorescence: METTL14 Antibody [NBP1-81392] - Staining of human cell line A-431 shows localization to nucleoplasm. Antibody staining is shown in green.

Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Staining of human kidney shows moderate to strong nuclear positivity in glomeruli and cells in tubules.

Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Immunohistochemical staining of human testis shows moderate to strong nuclear positivity in cells in seminiferous ducts.

Immunohistochemistry-Paraffin: METTL14 Antibody [NBP1-81392] - Staining of human fallopian tube shows strong nuclear positivity in glandular cells.

Simple Western: METTL14 Antibody [NBP1-81392] - Simple Western lane view shows a specific band for METTL14 in 0.2 mg/ml of NIH-3T3 lysate. This experiment was performed under reducing conditions using the 12-230 kDa separation system.

• Reactivity: Hu, Mu, Rt
• Applications: WB, Simple Western, ICC/IF, IHC
• Clonality: Polyclonal
• Host: Rabbit
• Conjugate: Unconjugated
• Format: BSA Free

METTL14 Antibody - BSA Free Summary

• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: RSWNMDSRLQEIRERQKLRRQLLAQQLGAESADSIGAVLNSKDEQREIAETRETCRASYDTSAPNAKRKYLDEGETDEDKMEEYKDELEMQQDEE
• Predicted Species: Mouse (92%), Rat (92%). Backed by our 100% Guarantee.
• Isotype: IgG
• Clonality: Polyclonal
• Host: Rabbit
• Gene: METTL14
• Purity: Immunogen affinity purified

Applications/Dilutions

• Dilutions:
  • Immunocytochemistry/ Immunofluorescence 0.25-2 ug/ml
  • Immunohistochemistry 1:1000 - 1:2500
  • Immunohistochemistry-Paraffin 1:1000 - 1:2500
  • Simple Western 1:20
  • Western Blot Reported scientific literature (PMID:26458103)
• Application Notes: ICC/IF Fixation Permeabilization: Use PFA/Triton X-100. IHC-Paraffin HIER pH6 retrieval is recommended. Simple Western only 10 - 15 uL of the recommended dilution is used per data point.
  See Simple Western Antibody Database for Simple Western validation: Tested in RT-4, NIH-3T3, separated by Size, antibody dilution of 1:20, apparent MW was 64 kDa. Separated by Size-Wes, Sally Sue/Peggy Sue.
• Control Peptide:

  METTL14 Protein (NBP1-81392PEP)

Packaging, Storage & Formulations

• Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Buffer: PBS (pH 7.2) and 40% Glycerol
• Preservative: 0.02% Sodium Azide
• Purity: Immunogen affinity purified

Alternate Names for METTL14 Antibody - BSA Free

• EC 2.1.1
• EC 2.1.1.-
• KIAA1627
• KIAA1627methyltransferase-like protein 14
• methyltransferase like 14
• METTL14

Background

Probable methyltransferase

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Publications for METTL14 Antibody (NBP1-81392)(10)

Publications using NBP1-81392

• Xiao L, De Jesus DF, Ju CW, Wei JB et Al. m(6)A mRNA methylation in brown fat regulates systemic insulin sensitivity via an inter-organ prostaglandin signaling axis independent of UCP1 Cell Metab 2024-09-10 [PMID: 39255799]
• Zhu Y, Zhang Y, Jiang Y et Al. Retinoic Acid Upregulates METTL14 Expression and the m(6)A Modification Level to Inhibit the Proliferation of Embryonic Palate Mesenchymal Cells in Cleft Palate Mice Int J Mol Sci 2024-04-20 [PMID: 38674123]
• Foucault, L;Capeliez, T;Angonin, D;Lentini, C;Bezin, L;Heinrich, C;Parras, C;Donega, V;Marcy, G;Raineteau, O; Neonatal brain injury unravels transcriptional and signaling changes underlying the reactivation of cortical progenitors Cell reports 2024-02-12 [PMID: 38349790]
• Jian D, Wang Y, Jian L et al. METTL14 aggravates endothelial inflammation and atherosclerosis by increasing FOXO1 N6-methyladeosine modifications Theranostics 2020-07-11 [PMID: 32802173] (Human)
• Jiang C, Trudeau S. J, et al. CRISPR/Cas9 Screens Reveal Multiple Layers of B cell CD40 Regulation. Cell Rep 2019-07-30 [PMID: 31365872] (WB, Human)
• Winkler R, Gillis E, Lasman L et al. m6A modification controls the innate immune response to infection by targeting type I interferons Nat. Immunol. 2018-12-17 [PMID: 30559377] (WB, Human)
• Zhou J, Wan J, Gao X et al. Dynamic m6A mRNA methylation directs translational control of heat shock response. Nature. 2015-10-12 [PMID: 26458103] (ICC/IF, WB, Human)
• Liu N, Dai Q, Zheng G et al. N6-methyladenosine-dependent RNA structural switches regulate RNA-protein interactions. Nature 2015-02-26 [PMID: 25719671] (WB, Human)
• Wang Y, Li Y, Toth JI et al. N6-methyladenosine modification destabilizes developmental regulators in embryonic stem cells. Nat Cell Biol 2014-02-01 [PMID: 24394384]
• Liu J, Yue Y, Han D et al. A METTL3-METTL14 complex mediates mammalian nuclear RNA N6-adenosine methylation. Nat Chem Biol 2014-02-01 [PMID: 24316715]

Bioinformatics

• Gene Symbol: METTL14