Mesp1 Partial Protein

Images

 

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB, ELISA, PA

Order Details

Mesp1 Partial Protein Summary

Description
Recombinant protein with GST-tag at N-terminal corresponding to the amino acids 1 - 63 of Human MESP1 partial ORF

Source: Wheat Germ (in vitro)

Amino Acid Sequence:MAQPLCPPLSESWMLSAAWGPTRRPPPSDKDCGRSLVSSPDSWGSTPADSPVASPARPGTLRD

Protein/Peptide Type
Partial Protein
Gene
MESP1

Applications/Dilutions

Application Notes
This protein has not been tested for any functionality. Product may contain endotoxins and is not suitable for use with live cells.

Packaging, Storage & Formulations

Storage
Store at -80C. Avoid freeze-thaw cycles.
Buffer
100% acetonitrile

Notes

This product is produced by and distributed for Abnova, a company based in Taiwan.

Alternate Names for Mesp1 Partial Protein

  • BHLHC5
  • bHLHc5MGC10676
  • Class C basic helix-loop-helix protein 5
  • mesoderm posterior 1 homolog (mouse)
  • mesoderm posterior protein 1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Peptides and proteins are guaranteed for 3 months from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP2-37424
Species: Hu
Applications: WB, ELISA
NBP1-31558
Species: Hu, Mu
Applications: WB, Flow, ICC/IF
NBP1-45057
Species: Hu, Mu, Rt, Po
Applications: WB, ICC/IF, IHC, IHC-P
AF6915
Species: Hu, Mu, Rt
Applications: WB
NB100-2379
Species: Hu, Mu, Rt, Pm
Applications: WB, Flow, ICC/IF
AF1837
Species: Hu
Applications: WB, Simple Western, ICC
NBP2-46076
Species: Hu
Applications: WB, IHC
355-BM/CF
Species: Hu, Mu, Rt
NBP1-80699
Species: Hu
Applications: IHC, IHC-P
NB100-78486
Species: Hu, Mu, Rt(-)
Applications: WB, Flow, ICC/IF, IHC, IHC-P, IP, CyTOF-ready
NBP1-32895
Species: Hu, Mu, Rt
Applications: WB
AF1172
Species: Hu, Mu, Rt, Ca
Applications: WB, Simple Western, Flow, IHC, CyTOF-ready, ICC
NBP2-39097
Species: Hu
Applications: WB, IHC, IHC-P
NBP2-45731
Species: Hu, Ca, Mk
Applications: WB, IHC, IHC-P
AF644
Species: Mu
Applications: WB, Flow, IHC, CyTOF-ready, Neut
NB600-1287
Species: Hu, Mu, Rt
Applications: WB, Flow, IP, CyTOF-ready
NBP2-38640
Species: Hu
Applications: IHC, IHC-P

Publications for Mesp1 Partial Recombinant Protein (H00055897-Q01) (0)

There are no publications for Mesp1 Partial Recombinant Protein (H00055897-Q01).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Mesp1 Partial Recombinant Protein (H00055897-Q01) (0)

There are no reviews for Mesp1 Partial Recombinant Protein (H00055897-Q01). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Mesp1 Partial Recombinant Protein (H00055897-Q01) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Additional Mesp1 Products

Bioinformatics Tool for Mesp1 Partial Recombinant Protein (H00055897-Q01)

Discover related pathways, diseases and genes to Mesp1 Partial Recombinant Protein (H00055897-Q01). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Mesp1 Partial Recombinant Protein (H00055897-Q01)

Discover more about diseases related to Mesp1 Partial Recombinant Protein (H00055897-Q01).
 

Pathways for Mesp1 Partial Recombinant Protein (H00055897-Q01)

View related products by pathway.

PTMs for Mesp1 Partial Recombinant Protein (H00055897-Q01)

Learn more about PTMs related to Mesp1 Partial Recombinant Protein (H00055897-Q01).

Blogs on Mesp1

There are no specific blogs for Mesp1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

BMP-2 [Unconjugated]
355-BM-010/CF

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Mesp1 Partial Protein and receive a gift card or discount.

Bioinformatics

Gene Symbol MESP1