Melanoma antigen family E1 Antibody

Images

 
Immunocytochemistry/ Immunofluorescence: Melanoma antigen family E1 Antibody [NBP1-88031] - Staining of human cell line A-431 shows positivity in cytoplasm.
Immunohistochemistry-Paraffin: Melanoma antigen family E1 Antibody [NBP1-88031] - Staining of human cerebral cortex shows strong cytoplasmic positivity in neuronal cells.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications ICC/IF, IHC, IHC-P
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Melanoma antigen family E1 Antibody Summary

Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:STLFSSSASVDRNPSKCSLVLPSPRVTKASVDSDSEGPKGAEGPIEFEVLRDCESPNSISIMGLNTSRVAITLKPQDPMEQNVAELLQFLLVKDQSKYPIRE
Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEE1
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
  • Immunohistochemistry
  • Immunohistochemistry-Paraffin 1:20 - 1:50
Application Notes
For IHC-Paraffin, HIER pH 6 retrieval is recommended. Immunocytochemistry/Immunofluorescence Fixation Permeabilization: Use PFA/Triton X-100.
Control Peptide
Melanoma antigen family E1 Protein (NBP1-88031PEP)

Packaging, Storage & Formulations

Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Buffer
PBS (pH 7.2) and 40% Glycerol
Preservative
0.02% Sodium Azide
Purity
Immunogen affinity purified

Alternate Names for Melanoma antigen family E1 Antibody

  • Alpha-dystrobrevin-associated MAGE Protein
  • DAMAGEMAGE-E1 antigen
  • HCA1
  • hepatocellular carcinoma-associated HCA1
  • Hepatocellular carcinoma-associated protein 1
  • KIAA1587dystrobrevin-associated MAGE protein
  • melanoma antigen family E, 1
  • melanoma-associated antigen E1

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-92180
Species: Hu, Rt
Applications: ICC/IF, IHC, IHC-P
NBP1-81765
Species: Hu
Applications: IHC, IHC-P
NBP2-36776
Species: Hu
Applications: WB, ICC/IF, IHC, IHC-P
NB120-22711
Species: Hu, Mu
Applications: ELISA, ICC/IF, IHC, IHC-Fr, IHC-P
AF2180
Species: Hu
Applications: WB, Simple Western, IP
AF1936
Species: Hu
Applications: WB, IP
NB120-2941
Species: Hu, Mu, Rt, Bv, Pm
Applications: WB, IHC, IHC-P
MAB38352
Species: Hu, Mu
Applications: WB, ICC
NBP2-36561
Species: Hu, Mu
Applications: WB, B/N, ELISA, Flow, ICC/IF, IHC-Fr, IP
NBP2-14014
Species: Hu
Applications: IHC, IHC-P
NLS6599
Species: Hu, Mk, Pm
Applications: IHC-P
NB300-538
Species: Hu, Mu, Rt, Rb
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P
NBP1-87441
Species: Hu, Mu, Rt
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-16468
Species: Hu, Rt
Applications: WB, IHC, IHC-P
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP

Publications for Melanoma antigen family E1 Antibody (NBP1-88031) (0)

There are no publications for Melanoma antigen family E1 Antibody (NBP1-88031).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melanoma antigen family E1 Antibody (NBP1-88031) (0)

There are no reviews for Melanoma antigen family E1 Antibody (NBP1-88031). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

ICC/IF Video Protocol

FAQs for Melanoma antigen family E1 Antibody (NBP1-88031) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Melanoma antigen family E1 Products

Bioinformatics Tool for Melanoma antigen family E1 Antibody (NBP1-88031)

Discover related pathways, diseases and genes to Melanoma antigen family E1 Antibody (NBP1-88031). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melanoma antigen family E1 Antibody (NBP1-88031)

Discover more about diseases related to Melanoma antigen family E1 Antibody (NBP1-88031).
 

Pathways for Melanoma antigen family E1 Antibody (NBP1-88031)

View related products by pathway.

Blogs on Melanoma antigen family E1

There are no specific blogs for Melanoma antigen family E1, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Melanoma antigen family E1 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEE1