Melanoma antigen family C2 Antibody

Images

 
Western Blot: Melanoma antigen family C2 Antibody [NBP1-68961] - Titration: 0.2-1 ug/ml, Positive Control: 721_B cell lysate.

Product Details

Summary
Reactivity HuSpecies Glossary
Applications WB
Clonality
Polyclonal
Host
Rabbit
Conjugate
Unconjugated

Order Details

Melanoma antigen family C2 Antibody Summary

Immunogen
Synthetic peptides corresponding to MAGEC2 (melanoma antigen family C, 2) The peptide sequence was selected from the N terminal of MAGEC2. Peptide sequence SCCSSFSWSSFSEESSSQKGEDTGTCQGLPDSESSFTYTLDEKVAELVEF.
Isotype
IgG
Clonality
Polyclonal
Host
Rabbit
Gene
MAGEC2
Purity
Immunogen affinity purified
Innovator's Reward
Test in a species/application not listed above to receive a full credit towards a future purchase.

Applications/Dilutions

Dilutions
  • Western Blot 1:100-1:2000
Application Notes
This is a rabbit polyclonal antibody against MAGEC2 and was validated on Western blot.
Theoretical MW
41 kDa.
Disclaimer note: The observed molecular weight of the protein may vary from the listed predicted molecular weight due to post translational modifications, post translation cleavages, relative charges, and other experimental factors.

Packaging, Storage & Formulations

Storage
Store at -20C. Avoid freeze-thaw cycles.
Buffer
PBS and 2% Sucrose
Preservative
0.09% Sodium Azide
Purity
Immunogen affinity purified

Notes

The addition of 50% glycerol is optional for those storing this antibody at -20C and not aliquoting smaller units. However, please note that glycerol may interrupt some downstream antibody applications and should be added with caution.

Alternate Names for Melanoma antigen family C2 Antibody

  • Cancer/testis antigen 10
  • CT10MAGE-E1 antigen
  • HCA587MAGE-C2
  • hepatocellular cancer antigen 587
  • Hepatocellular carcinoma-associated antigen 587
  • MAGE-C2 antigen
  • MAGEE1MGC13377
  • melanoma antigen family C, 2
  • melanoma antigen, family E, 1, cancer/testis specific
  • melanoma-associated antigen C2

Background

This gene is a member of the MAGEC gene family. It is not expressed in normal tissues, except for testis, and is expressed in tumors of various histological types. This gene and the other MAGEC genes are clustered on chromosome Xq26-q27.

Limitations

This product is for research use only and is not approved for use in humans or in clinical diagnosis. Primary Antibodies are guaranteed for 1 year from date of receipt.

Customers Who Viewed This Item Also Viewed...

NBP1-85397
Species: Hu
Applications: IHC, IHC-P
NBP2-37568
Species: Hu
Applications: WB, ELISA, Flow, ICC/IF, IHC
NBP1-47714
Species: Hu, Mk
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-45719
Species: Hu
Applications: WB, IHC
AF2685
Species: Hu
Applications: WB, Simple Western, IHC
H00006757-M01
Species: Hu
Applications: WB, ELISA, IHC-P
NBP2-49659
Species: Hu
Applications: IHC, IHC-P
NB300-229
Species: Mu, Rt, Ma, Pa, Hu(-)
Applications: WB, Simple Western, ChIP, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP1-84355
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP1-47974
Species: Hu, Rt, Ca, Pm
Applications: WB, ICC/IF, IHC, IHC-P
NBP2-29469
Species: Hu, Rt, Ca
Applications: WB, ELISA, Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP
NBP2-45720
Species: Hu
Applications: WB, IHC, IF
NBP2-46702
Species: Hu
Applications: ICC/IF, IHC, IHC-P
NBP2-00532
Species: Hu, Mu, Rt, Ca, Mk
Applications: WB, Flow, ICC/IF, IHC, IHC-P
NBP1-49045
Species: Mu, Rt
Applications: Flow, ICC/IF, IHC, IHC-Fr, IHC-P, IP, Cell Depl, CyTOF-ready, InhibTFunc
AF5414
Species: Hu
Applications: WB, Simple Western

Publications for Melanoma antigen family C2 Antibody (NBP1-68961) (0)

There are no publications for Melanoma antigen family C2 Antibody (NBP1-68961).
By submitting your publication information earn gift cards and discounts for future purchases.

Reviews for Melanoma antigen family C2 Antibody (NBP1-68961) (0)

There are no reviews for Melanoma antigen family C2 Antibody (NBP1-68961). By submitting a review you will receive an Amazon e-Gift Card or Novus Product Discount.
  • Review with no image -- $10/€7/£6/$10 CAD/¥70 Yuan/¥1110 Yen
  • Review with an image -- $25/€18/£15/$25 CAD/¥150 Yuan/¥2500 Yen
  • 1st to review with an image -- $50/€35/£30/$50 CAD/¥300 Yuan/¥5000 Yen

Product General Protocols

Find general support by application which include: protocols, troubleshooting, illustrated assays, videos and webinars.

Video Protocols

WB Video Protocol

FAQs for Melanoma antigen family C2 Antibody (NBP1-68961) (0)

There are no specific FAQs related to this product. Read our general customer & technical service FAQs.

Secondary Antibodies

 

Isotype Controls

Additional Melanoma antigen family C2 Products

Bioinformatics Tool for Melanoma antigen family C2 Antibody (NBP1-68961)

Discover related pathways, diseases and genes to Melanoma antigen family C2 Antibody (NBP1-68961). Need help? Read the Bioinformatics Tool Guide for instructions on using this tool.
Visit Tool

Diseases for Melanoma antigen family C2 Antibody (NBP1-68961)

Discover more about diseases related to Melanoma antigen family C2 Antibody (NBP1-68961).
 

Pathways for Melanoma antigen family C2 Antibody (NBP1-68961)

View related products by pathway.

PTMs for Melanoma antigen family C2 Antibody (NBP1-68961)

Learn more about PTMs related to Melanoma antigen family C2 Antibody (NBP1-68961).

Blogs on Melanoma antigen family C2

There are no specific blogs for Melanoma antigen family C2, but you can read our latest blog posts.

Customers Who Bought This Also Bought

Contact Information

Product PDFs

Calculators

Concentration Calculator

The concentration calculator allows you to quickly calculate the volume, mass or concentration of your vial. Simply enter your mass, volume, or concentration values for your reagent and the calculator will determine the rest.

=
÷

Review this Product

Be the first to review our Melanoma antigen family C2 Antibody and receive a gift card or discount.

Bioinformatics

Gene Symbol MAGEC2
Uniprot